Provided is a method for pretreating waste fat, oil and grease (FOG) and co-producing a first-generation biodiesel, including: S1, feeding waste FOG, a liquid acid catalyst, and methanol into a pre-esterification reactor, and conducting pre-esterification to obtain a pre-esterification mixed liquid; S2, removing waste residues from the pre-esterification mixed liquid through a filter to obtain a filtrate, and separating the filtrate by a liquid-liquid separator to obtain an organic phase and an aqueous phase; S3, introducing the organic phase into a methanol recovery tower I and conducting separation to obtain a pre-esterification product and crude methanol; introducing the aqueous phase into a methanol recovery tower II and conducting another separation to obtain a liquid acid catalyst and crude methanol; S4, separating the pre-esterification product through a biodiesel refining tower to obtain a first-generation biodiesel product, and a pretreated waste FOG at a tower bottom.
A catalyst for chemical pretreatment of waste fat, oil and/or grease, and a preparation method and use thereof. The catalyst includes three components of component A, component B, and component C; wherein the component A is a Bronsted acid protic ionic liquid composed of a linear or heterocyclic tertiary amine cation and an anion, the component B is at least one selected from the group made of organic acid and inorganic acid; the component C is at least one selected from low-carbon alcohols; and a mass ratio of the component A, the component B and the component C is in a range of (1.0-4.0):(0.01-0.3):(1.0-6.0). The catalyst is prepared by subjecting corresponding anions and cations to one-step neutralization reaction to obtain component A, and then mechanically mixing component A, and components B and C.
B01J 31/02 - Catalysts comprising hydrides, coordination complexes or organic compounds containing organic compounds or metal hydrides
B01J 27/02 - Sulfur, selenium or telluriumCompounds thereof
B01J 35/27 - Catalysts, in general, characterised by their form or physical properties characterised by their non-solid state in a liquid or molten state
Provided in the present invention is an optical-electrical separation type pico projection optical structure based on image transmission optical fibers. The structure is mainly composed of a display module, an optical module and an image transmission module, wherein the display module is composed of one or more micro-display chips, and a drive and a power source part of each micro-display chip; the optical module is an image-space telecentric pico projection lens composed of at least one spherical or non-spherical lens; and the image transmission module is composed of an optical fiber bundle formed by a large number of image transmission optical fibers arranged in an array, and a micro-collimation element array added when necessary. In the present invention, by means of combining the micro-display chips, the image transmission optical fibers and the pico projection lens, a pico projection structure in which an optical module is effectively separated from an electrical module is realized. The pico projection structure can be applied to near-eye display devices such as a smart helmet and smart glasses, greatly enhancing the structural flexibility of the pico projection structure; in addition, the pico projection structure is more suitable for use in special environments with relatively large effects on electronic devices, such as an underwater environment and a strong magnetic field.
G02B 6/06 - Light guidesStructural details of arrangements comprising light guides and other optical elements, e.g. couplings formed by bundles of fibres the relative position of the fibres being the same at both ends, e.g. for transporting images
G02B 27/20 - Optical systems or apparatus not provided for by any of the groups , for optical projection, e.g. combination of mirror and condenser and objective for imaging minute objects, e.g. light-pointer
G03B 21/14 - Projectors or projection-type viewersAccessories therefor Details
G02B 13/22 - Telecentric objectives or lens systems
G02B 6/00 - Light guidesStructural details of arrangements comprising light guides and other optical elements, e.g. couplings
The present invention relates to an adaptive cube indexing method and system. The method comprises: for the topological relationship between adaptive cube tiles and geometries, setting topological type coding rules for segmenting and calibrating geometry indexes which are generated on the basis of the present file; on the basis of a multi-level tree structure of tiled adaptive cubes and the topological type coding rules, segmenting geometry identifiers of various geometric types such as multi-point, line, surface, solid or grid geometries which express earth phenomena, to generate a multi-level topological index, and storing the multi-level topological index; defining a request tile area on the basis of an access request to obtain access topological type coding rules; and acquiring the geometry indexes within the tile area range on the basis of the topological type coding rules, filtering redundant geometry indexes within the tile area range, and accessing corresponding target geometry data on the basis of the filtered geometry indexes. The present invention improves the access efficiency of target geometries of adaptive cubes, and improves the performance of an adaptive cube-based earth phenomenon instant-analysis application.
G06F 16/583 - Retrieval characterised by using metadata, e.g. metadata not derived from the content or metadata generated manually using metadata automatically derived from the content
G06F 16/587 - Retrieval characterised by using metadata, e.g. metadata not derived from the content or metadata generated manually using geographical or spatial information, e.g. location
A Collaborative Caching Framework for Multi-edge Systems with Robust Federated Deep Learning is provided. First, we design a new partitioning mechanism for multi-dimensional cache space, enabling precise content recommendations in user classification intervals. Next, we develop a VQ-VAE-based accurate prediction for content popularity by overcoming posterior collapse. Finally, we create a new training mode and proactive cache replacement strategy based on robust federated deep learning. Specifically, residual-based detection for adversarial model updates and similarity-based federated aggregation are integrated to avoid the model destruction caused by adversarial updates, which enables the proactive cache replacement adapting to optimized cache resources and thus enhances cache performance. Using real-world testbed and MovieLens datasets, extensive experiments verify that RoCoCache achieves higher cache hit rates and efficiency than benchmark methods while ensuring better robustness. Moreover, we demonstrate the effectiveness of the components designed in RoCoCache via ablation experiments.
A profit-aware Offloading Framework towards Prediction-assisted MEC Network Slicing is provided. Towards MEC network slicing, formulate the optimization problem of maximizing long-term ESP profits and decouple it into the sub-problems of Edge network Slicing (EnS) and Computation offloading Access (CoA); For the slicing sub-problem, use a gated recurrent neural network (GRNN) to accurately predict user requests in different regions, and then use the optimal partitioning of network slices with the predicted requests and expected demands; For the offloading sub-problem, incorporating results from slice parti-tioning, use an improved deep reinforcement learning with twin ritic-networks and delay mechanism, solving the Q-value overestimation and high variance for approximating the optimal offloading and resource allocation.
The present invention relates to a QoS-aware service migration method in an IoV system based on CVX deep reinforcement learning. Firstly, the optimization problem of service migration and resource allocation is decoupled into two sub-problems; then, a new actor-critic-based asynchronous-update deep reinforcement learning method is designed to explore the optimal service migration, where a delayed-update actor makes decisions of service migration and a one-step-update critic evaluates the decisions to guide the direction of the policy update; and on this basis, an optimal resource allocation method for an MEC server based on convex optimization is proposed to achieve the optimal resource allocation. According to the method of the present invention, extensive experiments are conducted based on a real-world testbed and a dataset of city vehicle trajectories, thereby verifying the feasibility and effectiveness of SeMiR. Compared with benchmark methods, the SeMiR of the present invention has the best performance of service migration under various scenarios.
A Edge-Client Collaborative Federated Graph Learning with Adaptive Neighbor Generation is provided. To promote the information flow in edge-client collaboration and extract more generalized potential relationships between clients. In SpreadFGL, an adaptive graph imputation generator incorporated with a versatile assessor is first designed to exploit the potential links between subgraphs, without sharing raw data. Next, a new negative sampling mechanism is developed to make SpreadFGL concentrate on more refined information in downstream tasks. To facilitate load balancing at the edge layer, SpreadFGL follows a distributed training manner that enables fast model convergence. Using real-world testbed and benchmark graph datasets, extensive experiments demonstrate the effectiveness of the proposed SpreadFGL.
A computation offloading approach in blockchain-enabled MCS systems is provided to reach a lower total cost in computation offloading. Firstly, building a consortium blockchain-based framework to guarantee secure transactions in MCS systems. Secondly, designing a novel credit-based proof-of-work (C-PoW) algorithm instead of PoW to confirm transactions and add new blocks to the chain, thereby relieving the complexity of PoW while keeping the reliability of blockchain. Thirdly, using a scalable deep reinforcement learning based computation offloading (DRCO) method to handle the computation-intensive tasks of C-PoW; by integrating PPO and DNC, the DRCO executes differentiable read-write operations on structured external memories by following an objective-oriented way; the DRCO uses a clipped surrogate objective to control the update of offloading policy, in order to improve the decision-making efficiency; the DRCO uses the DNNs to address the problem of high-dimensional state space.
A computation offloading approach in blockchain-enabled MCS systems is provided to reach a lower total cost in computation offloading. Firstly, building a consortium blockchain-based framework to guarantee secure transactions in MCS systems. Secondly, designing a novel credit-based proof-of-work (C-PoW) algorithm instead of PoW to confirm transactions and add new blocks to the chain, thereby relieving the complexity of POW while keeping the reliability of blockchain. Thirdly, using a scalable deep reinforcement learning based computation offloading (DRCO) method to handle the computation-intensive tasks of C-PoW; by integrating PPO and DNC, the DRCO executes differentiable read-write operations on structured external memories by following an objective-oriented way; the DRCO uses a clipped surrogate objective to control the update of offloading policy, in order to improve the decision-making efficiency; the DRCO uses the DNNs to address the problem of high-dimensional state space.
H04L 9/00 - Arrangements for secret or secure communicationsNetwork security protocols
H04L 9/06 - Arrangements for secret or secure communicationsNetwork security protocols the encryption apparatus using shift registers or memories for blockwise coding, e.g. D.E.S. systems
11.
FREQUENCY-CONTROLLED CARRIER-FREE INJECTION-TYPE ACTIVE DISPLAY ARRAY DRIVING STRUCTURE
A frequency-controlled carrier-free injection-type active display array driving structure, comprising: row scanning lines, column scanning lines, pixel regions corresponding to each intersection region of the row scanning lines and the column scanning lines, and a frequency-modulated alternating-current signal source, wherein each pixel region is provided with row and column gating transistors and at least two carrier-free injection-type light-emitting devices of different inherent driving frequencies, and the row scanning lines, the column scanning lines, and the row and column gating transistors are used for gating the corresponding pixel region and loading the frequency-modulated alternating-current signal source to the carrier-free injection-type light-emitting devices; and the carrier-free injection-type light-emitting devices are lit for work under frequency-modulated alternating-current signal sources at different frequencies on the basis of the different inherent driving frequencies of the carrier-free injection-type light-emitting devices. Under the same light-emitting pixel conditions, the number of row scanning lines and the number of column scanning lines are decreased to reduce the area of a scanning circuit, thereby reducing the preparation complexity of a display circuit.
G09G 3/32 - Control arrangements or circuits, of interest only in connection with visual indicators other than cathode-ray tubes for presentation of an assembly of a number of characters, e.g. a page, by composing the assembly by combination of individual elements arranged in a matrix using controlled light sources using electroluminescent panels semiconductive, e.g. using light-emitting diodes [LED]
12.
EDGE-CLIENT COLLABORATIVE FEDERATED GRAPH LEARNING WITH ADAPTIVE NEIGHBOR GENERATION
An Edge-Client Collaborative Federated Graph Learning with Adaptive Neighbor Generation is provided. To promote the information flow in edge-client collaboration and extract more generalized potential relationships between clients. In SpreadFGL, an adaptive graph imputation generator incorporated with a versatile assessor is first designed to exploit the potential links between subgraphs, without sharing raw data. Next, a new negative sampling mechanism is developed to make SpreadFGL concentrate on more refined information in downstream tasks. To facilitate load balancing at the edge layer, SpreadFGL follows a distributed training manner that enables fast model convergence. Using real-world testbed and benchmark graph datasets, extensive experiments demonstrate the effectiveness of the proposed SpreadFGL.
A QoS-aware service migration method in an IoV system based on CVX deep reinforcement learning is provided. Firstly, the optimization problem of service migration and resource allocation is decoupled into two sub-problems; then, a new actor-critic-based asynchronous-update deep reinforcement learning method is designed to explore the optimal service migration, where a delayed-update actor makes decisions of service migration and a one-step-update critic evaluates the decisions to guide the direction of the policy update; and on this basis, an optimal resource allocation method for an MEC server based on convex optimization is proposed to achieve the optimal resource allocation. According to the QoS-aware service migration method, extensive experiments are conducted based on a real-world testbed and a dataset of city vehicle trajectories, thereby verifying the feasibility and effectiveness of SeMiR. Compared with benchmark methods, the SeMiR has the best performance of service migration under various scenarios.
A Collaborative Caching Framework for Multi-edge Systems with Robust Federated Deep Learning is provided. First, we design a new partitioning mechanism for multi-dimensional cache space, enabling precise content recommendations in user classification intervals. Next, we develop a VQ-VAE-based accurate prediction for content popularity by overcoming posterior collapse. Finally, we create a new training mode and proactive cache replacement strategy based on robust federated deep learning. Specifically, residual-based detection for adversarial model updates and similarity-based federated aggregation are integrated to avoid the model destruction caused by adversarial updates, which enables the proactive cache replacement adapting to optimized cache resources and thus enhances cache performance. Using real-world testbed and MovieLens datasets, extensive experiments verify that RoCoCache achieves higher cache hit rates and efficiency than benchmark methods while ensuring better robustness. Moreover, we demonstrate the effectiveness of the components designed in RoCoCache via ablation experiments.
Provided are a transdermal delivery system for nanodrug, a preparation method therefor, and use thereof. In the described transdermal delivery system for nanodrug, lipoic acid is used as a drug carrier to encapsulate a chemotherapeutic drug and/or a photodynamic agent, and nanoparticles containing 1,2-dithiolane are formed by means of self-assembly. For the first time, lipoic acid is used as a carrier-assisted small molecule in the transdermal delivery system, which eliminates the need for an additional transdermal penetration enhancer. The system is not restricted by the location of the skin or the number of appendages, and does not require the assistance of devices for drug administration, but only simple application to achieve efficient transdermal penetration. The drug administration method is non-invasive, allowing for efficient transdermal penetration without disrupting the stratum corneum, thereby reducing the risk of skin infection. The depth of transdermal penetration can reach 1 mm or more, making the system suitable for both superficial and deep skin diseases. The system can be operated independently, significantly reducing costs and providing high safety. On the basis of this, the type of drug to be loaded can be flexibly changed according to the type of skin disease, enabling more precise treatment.
The present disclosure belongs to the technical field of arch bridge structures, and particularly relates to a steel-concrete combined skewback structure and a construction method thereof. In the present disclosure, by arranging arch rib tubes, concrete sections in a main chord pipe, concrete blocks in a skewback, fixing steel tubes, a transverse diaphragm unit, and a vertical diaphragm unit, the steel-concrete combined skewback structure can achieve the following objectives that 1. the skewback structure can be fully connected with a bearing platform; and 2. the fixing steel tubes are fully filled with concrete. In addition, the present disclosure further provides the construction method of the above steel-concrete combined skewback structure. The construction method the skewback structure itself and its mounting manner both have sufficient structural stability.
Provided is a chemical pretreatment system for waste fat, oil and grease (FOG), including: a catalyst preparation device; a first esterification reactor; a first separation device; a second separation device; an evaporation device set; a cooling device; and a methanol separation device. The first separation device is connected with an outlet of the first esterification reactor and connected with an inlet end of the second separation device. The second separation device is connected with an evaporation device by a first outlet and with another evaporation device by a second outlet. Outlets of multiple evaporation devices simultaneously connect with the cooling device which connects with the methanol separation device. A reflux device is connected with an outlet of the methanol separation device and also connected with the first esterification reactor.
C11C 3/04 - Fats, oils or fatty acids obtained by chemical modification of fats, oils or fatty acids, e.g. by ozonolysis by esterification of fats or fatty oils
B01D 15/08 - Selective adsorption, e.g. chromatography
A chemical pretreatment process for waste fat, oil and/or grease (FOG) includes three working sections: first, subjecting the waste FOG to esterification reaction to prepare a fatty acid methyl ester; second, subjecting a crude product obtained from the esterification reaction and a catalyst to liquid-liquid phase separation through a chromatograph device to obtain a crude product solution in a form of oil phase and a catalyst solution in a form of aqueous phase, respectively separating the aqueous phase and the oil phase through evaporation systems to obtain a crude product, catalyst and methanol and water, storing temporarily the crude product in a storage tank, and recycling the catalyst back to the reactor; and finally, refining the methanol aqueous solution through a distillation tower to obtain high-purity methanol, which is returned to the reactor for recycling, and introducing a resulting wastewater to a storage tank.
A profit-aware Offloading Framework towards Prediction-assisted MEC Network Slicing is provided. Towards MEC network slicing, formulate the optimization problem of maximizing long-term ESP profits and decouple it into the sub-problems of Edge network Slicing (EnS) and Computation offloading Access (CoA). For the slicing sub-problem, use a gated recurrent neural network (GRNN) to accurately predict user requests in different regions, and then use the optimal partitioning of network slices with the predicted requests and expected demands; For the offloading sub-problem, incorporating results from slice partitioning, use an improved deep reinforcement learning with twin ritic-networks and delay mechanism, solving the Q-value overestimation and high variance for approximating the optimal offloading and resource allocation.
H04L 41/0826 - Configuration setting characterised by the purposes of a change of settings, e.g. optimising configuration for enhancing reliability for reduction of network costs
H04L 41/0895 - Configuration of virtualised networks or elements, e.g. virtualised network function or OpenFlow elements
H04L 41/16 - Arrangements for maintenance, administration or management of data switching networks, e.g. of packet switching networks using machine learning or artificial intelligence
20.
METHOD FOR PREPARING ANTI-SINTERING CALCIUM-BASED ENERGY STORAGE MATERIAL BY VACUUM FREEZE-DRYING
Disclosed is a method for preparing the anti-sintering calcium-based energy storage material by vacuum freeze-drying, which includes preparation of a precursor solution by mixing a calcium salt and a metal salt of manganese, magnesium, iron, cobalt, aluminum, zirconium, titanium, chromium, nickel, lanthanum, yttrium, molybdenum, or other metals in deionized water, vacuum freeze-drying of the precursor solution to obtain fluffy powder, and calcination of the powder in an air atmosphere to obtain the anti-sintering calcium-based energy storage material. The preparation method of the present invention does not require special equipment and harsh conditions, and has strong operability. The prepared calcium-based energy storage materials feature strong stability, high energy storage capacity, etc., and can be used in industrial production.
FZU ZIJIN HYDROGEN POWER TECHNOLOGY CO., LTD (China)
Inventor
Jiang, Lilong
Luo, Yu
Lin, Li
Chen, Chongqi
Zhang, Qing
Abstract
The invention discloses a system for producing hydrogen by ammonia decomposition reaction and a hydrogen production method. The system comprises an ammonia storage device, a heat exchange device, an ammonia decomposition reaction device, a first compression device and a first adsorption device, and the ammonia storage device is in communication with a gas inlet of the ammonia decomposition reaction device through a cold liquid channel on the heat exchange device; and a gas outlet of the ammonia decomposition reaction device is in communication with the first adsorption device through a gas channel on the heat exchange device by means of the first compression device communicating with the first adsorption device; the first adsorption device comprises a plurality of adsorption columns arranged in parallel, the first compression device is in communication with inlets of a plurality of the adsorption columns at the same time, a control valve is arranged between the adsorption inlet of each adsorption column and the first compression device, and the adsorption outlets of a plurality of adsorption columns communicate with each other, a control valve is provided between adsorption outlets of two adjacent adsorption columns, and the adsorption inlet of each adsorption column is in communication with the ammonia decomposition reaction device. The system realizes cyclic utilization of tail gas after desorption of the adsorption column, and reduces the damage of ammonia gas and nitrogen oxides to the environment.
C01B 3/04 - Production of hydrogen or of gaseous mixtures containing hydrogen by decomposition of inorganic compounds, e.g. ammonia
B01D 53/04 - Separation of gases or vapoursRecovering vapours of volatile solvents from gasesChemical or biological purification of waste gases, e.g. engine exhaust gases, smoke, fumes, flue gases or aerosols by adsorption, e.g. preparative gas chromatography with stationary adsorbents
B01J 8/02 - Chemical or physical processes in general, conducted in the presence of fluids and solid particlesApparatus for such processes with stationary particles, e.g. in fixed beds
C01B 3/56 - Separation of hydrogen or hydrogen containing gases from gaseous mixtures, e.g. purification by contacting with solidsRegeneration of used solids
22.
Method for constructing geospatial grid region name interoperability protocol system
The provided is a method for constructing a geospatial grid region name interoperability protocol system. The method constructs the geospatial grid region name interoperability protocol system from four layers: a subdivision layer, a management layer, an association layer, and an application layer, specifically including a grid subdivision sub-protocol, a grid coding sub-protocol, a geospatial grid region name organization sub-protocol, a geospatial grid region name mapping sub-protocol, a geospatial grid region naming authorization sub-protocol, a geospatial grid region name-based code conversion sub-protocol, a geospatial grid region name interoperability sub-protocol, a geospatial grid region name registration sub-protocol, a geospatial grid region name resolution sub-protocol, etc., thereby achieving registration and resolution of a geospatial grid region name and mutual association and spatial interoperability of ubiquitous location information based on the geospatial grid region name.
G06F 15/173 - Interprocessor communication using an interconnection network, e.g. matrix, shuffle, pyramid, star or snowflake
H04L 61/4511 - Network directoriesName-to-address mapping using standardised directoriesNetwork directoriesName-to-address mapping using standardised directory access protocols using domain name system [DNS]
H04L 69/329 - Intralayer communication protocols among peer entities or protocol data unit [PDU] definitions in the application layer [OSI layer 7]
23.
Preparation Method of Nanofiltration Membrane with Tree-Like Structure and Use
Provided are a preparation method of a nanofiltration membrane with a tree-like structure and use. The preparation method includes: taking a cellulose fiber filter paper as a substrate, and allowing hydroxyapatite nanowire arrays to grow in situ through solvothermal synthesis to obtain a composite filter paper; and repeatedly soaking the composite filter paper in a solution of trimesic acid and iron chloride in ethanol to allow continuous deposition to obtain the nanofiltration membrane with the tree-like structure. The nanofiltration membrane with the tree-like structure of the present application has a larger surface roughness and a larger specific surface area than the conventional nanofiltration membranes, and thus exhibits a very high interception rate (higher than 94%) for anionic/cationic dyes and heavy metal ions Pb2+. Therefore, the nanofiltration membrane with the tree-like structure of the present application has excellent environmental benefits.
The present disclosure relates to a deep learning-based method for predicting a high-dimensional and highly-variable cloud workload, including the following steps: Step S1: obtaining historical workload data of a cloud data center, and carrying out preprocessing; Step S2: on the basis of a raw data set, predicting a future workload of a central processing unit by using a deep learning based prediction algorithm for cloud workloads (L-PAW) integrating a top-sparse auto-encoder (TSA) and a gated recurrent unit (GRU), and transmitting a predicted result to a cloud service provider (CSP); and Step S3: determining, by the CSP, a resource allocation strategy according to the predicted result, such that the cloud data center achieves load balancing. The present disclosure realizes adaptive and effective workload prediction, thereby effectively improving the efficient resource allocation efficiency in cloud computing.
A porous material based on a liquid metal, and a preparation method therefor and the use thereof. The porous material is obtained by mixing a liquid metal, which is obtained by heating and liquefying a metal, an organic solvent, a surfactant and copper foam, and then reacting same.
C25B 11/075 - Electrodes formed of electrocatalysts on a substrate or carrier characterised by the electrocatalysts material consisting of a single catalytic element or catalytic compound
The present invention relates to a multifunctional composite surgical device suitable for removal of calcified cardiovascular tissue. The device comprises a rotational-atherectomy operation handle, wherein a rotational-atherectomy cutter is connected to an outer face of the head of the rotational-atherectomy operation handle by means of a flexible transmission shaft, a micro-force sensor is mounted on a side of the rotational-atherectomy cutter, an intravascular imaging unit is mounted at the tip of the rotational-atherectomy cutter, an ultrasonic vibration unit and a rotational-atherectomy drive unit are mounted inside the rotational-atherectomy operation handle, and the micro-force sensor, the intravascular imaging unit, the ultrasonic vibration unit and the rotational-atherectomy drive unit are each electrically connected to a control module arranged inside the rotational-atherectomy operation handle. During a rotational-atherectomy process, the rotational-atherectomy cutter is controlled to perform a reciprocating motion at a high frequency within a small range, so as to achieve the aims of reducing the degree of interaction between the cutter and calcified tissue and decreasing the probability of the rotational-atherectomy cutter becoming stuck. In combination with intravascular ultrasonic imaging technology, the internal morphology of blood vessels in the vicinity of the cutting tool is imaged before and after rotational atherectomy, thereby providing data support for operators; and in combination with micro-force sensing technology, an impact force of the cutter can be acquired in real time during the rotational-atherectomy process.
Fuzhou Urban and Rural Construcation Group CO., Ltd (China)
Inventor
Huang, Yufan
Wu, Qingxiong
Chi, Shanqing
Cai, Dingxi
Chen, Kangming
Lin, En
Yang, Mingqing
Yang, Yilun
Han, Dongdong
Luo, Jianping
Abstract
The present disclosure belongs to the technical field of tools for bridge reinforcement, and particularly relates to a precisely-positioned drilling apparatus for steel tubular joints. According to the present disclosure, a lifting frame unit, an electric drill, a lever unit, a positioning tube unit, and a diagonal tensioning member unit are arranged on a base unit such that 1. during drilling, a drill rod is not prone to deviation, and a drilling action is relatively precise, resulting in an approximately circular shape of a final drilled hole; and 2. the above lever unit is essentially a labor-saving lever that ensures relatively easy and convenient drilling operations. Additionally, the present disclosure further discloses an application method of the apparatus, which ensures that the apparatus may stably fit with and be safely available for electric drills with various sizes and specifications.
B23B 39/00 - General-purpose boring or drilling machines or devicesSets of boring or drilling machines
B23B 35/00 - Methods for boring or drilling, or for working essentially requiring the use of boring or drilling machinesUse of auxiliary equipment in connection with such methods
28.
DEEP REINFORCEMENT LEARNING-BASED CLOUD DATA CENTER ADAPTIVE EFFICIENT RESOURCE ALLOCATION METHOD
The present invention relates to a deep reinforcement learning-based cloud data center adaptive efficient resource allocation method. First, an operation (a scheduling job) is selected according to a score evaluated by critic (an evaluation operation) by using an actor parameterized policy (resource allocation). Then, a resource allocation policy is updated through gradient boosting, and a variance of a policy gradient is reduced by using an advantage function, to improve training efficiency; and wide simulation experiments are performed by using real data from a Google cloud data center. Compared with two advanced DRL-based cloud resource allocation methods and five classic cloud resource allocation methods, the method provided in the present invention has higher quality of service (QoS) in terms of a delay and a job dropout rate and has higher energy efficiency.
An energy-consuming-type water hammer effect eliminating device for a submarine fluid-transposition pipeline, the device comprising a fixing flange (4) and a housing (1) fixedly connected to the fixing flange, wherein a first partition plate (15) and a second partition plate (17) are slidably connected to the inner wall of the housing; a reset assembly (12) for resetting the first partition plate and the second partition plate which have slid is provided in the housing; the first partition plate and the second partition plate divide the interior of the housing into a water storage chamber (7), an air storage chamber (6) and a buffer chamber (5), the water storage chamber, the air storage chamber and the buffer chamber being adjacently arranged in sequence, and the buffer chamber being located at the end close to the fixing flange; the bottom of the buffer chamber is fixedly connected to a water intake plate (8), and the inner side wall of the buffer chamber is fixedly connected to an adjustment plate (9); and the air storage chamber is in communication with a driving chamber by means of a pressure relief pipe (2) therebetween, and a bidirectional pressure relief valve (3) is provided on the pressure relief pipe. The device can linearly and stably eliminate a water hammer effect, and is almost not subject to any wear and tear during the entire elimination process, and the service life of the device can also be prolonged.
Provided in the present invention is a method for analyzing the vibration of a fluid conveying pipe on the basis of a Fourier featured PINN. The method comprises: constructing a physics-informed neural network (PINN), determining initial conditions and boundary conditions on the basis of a fluid conveying pipe model, and obtaining loss functions corresponding to the initial conditions and the boundary conditions; using a "soft" constraint to express a second-type boundary condition and initial excitation of a pipe into PINN loss functions, and using a "hard" constraint to code a first-type boundary condition and an initial amplitude into a DNN system structure; adding an observation anchor point to the network for correction when a peak value is insufficient during a network model training process; constructing a Fourier feature mapping function, adjusting a neural tangent kernel of the network, training two mapping results by means of a set network, and finally, in the network, connecting spatial and temporal hidden layers by means of point multiplication, so as to establish an FFNN; and by means of training and learning, finally outputting a prediction result by means of a linear layer connection.
G06F 30/18 - Network design, e.g. design based on topological or interconnect aspects of utility systems, piping, heating ventilation air conditioning [HVAC] or cabling
31.
Large-scale direct shear apparatus for direct shear test of multi-size cylindrical undisturbed soil samples
EAST CHINA SURVEY AND DESIGN INSTITUTE (FUJIAN) CO., LTD. (China)
Inventor
Chen, Zhibo
Cai, Jinyang
Yang, Hui
Xie, Yongning
Zeng, Xuming
Pan, Shenggui
Abstract
A large-scale direct shear apparatus for direct shear test of multi-size cylindrical undisturbed soil samples, comprising an external framework, a sample shear box, a horizontal loading device, a vertical loading device, and a control system. The sample shear box is disposed within the external framework and includes an upper shear box, a lower shear box, and a base. The horizontal loading device includes a horizontal drive motor equipped with a load sensor, a horizontal mechanical loading mechanism, and an upper shear box connection structure. The horizontal drive motor is installed on one inner side of the external framework and contacts the lower shear box via the horizontal mechanical loading mechanism. The upper shear box connection structure is fixed to the other inner side of the external framework and contacts the upper shear box. The vertical loading device includes a vertical drive motor and a vertical mechanical loading mechanism.
Provided in the present invention is a composite dielectric layer applied to non-contact electrical detection of a wafer-level LED chip. An electrode plate is a conductive planar substrate, an array of conductive micro tips is provided on the surface of the electrode plate, and a nano composite dielectric layer is further provided on the surface of the conductive micro tips. An array of micro tips is essentially provided on a conductive plane, such that surface electric fields can be effectively concentrated, thereby reducing the voltage required when a device works. Since a nano composite dielectric layer is arranged on the surface of micro tips, charge accumulation can be generated according to the change in an external electric field, so as to further stabilize a space electric field, and an LED chip can be driven without contact, thereby realizing low-voltage and stable wafer-level LED detection.
High-protein single-cell tea powder, and a preparation method therefor and a use thereof. Enzymolysis treatment is carried out on tea tissues by using a carbohydrate complex enzyme, intercellular substances that connect tea cell tissues are effectively degraded or dissolved, so that the tea tissues are fully dispersed, thereby efficiently obtaining tea mesophyll single cells with a complete structure. Particles of the high-protein single-cell tea powder obtained by means of the preparation method are uniform and fine, and the integrity of nutrient substances and flavor substances in the tea cells can be effectively maintained. In addition, due to released single cells having a complete structure, substances in cells are kept isolated from the external environment, and release of cell contents can be delayed so as to facilitate absorption and utilization of a human body, thereby avoiding nutrient loss caused by too fast release of nutrient substances in the cells.
A flexible wall device and method for measuring gas permeability coefficient and gas diffusion coefficient of unsaturated soil includes a gas washing device, a confining pressure-volume change system, a drying-wetting cycle control system and a gas measuring device. The drying-wetting cycle control system includes a humidity controller and valves. The gas measuring device includes a top lid, a cylindrical wall, a base, an upper chamber and a lower chamber. The top lid, the cylindrical wall and the base are connected by bolts and nuts, and the base has four passages, which are respectively connected to the gas washing device, the confining pressure-volume change system, the drying-wetting cycle control system and the gas measuring device, between the base and top lid are sequentially arranged from bottom to top as the lower chamber, lower perforated plate, lower permeable stone, sample, upper permeable stone, upper perforated plate, upper chamber, and control rod.
An application migration method from client-server architecture to blockchain architecture is provided. The application migration method includes the following steps: S1: modeling an application program of a conventional client-server architecture and abstracting the application program to a program call tree; S2: defining a taint propagation rule for taint analysis by taking key data as tainted data, to acquire all taint variables in the application program; and S3: identifying a key module of the application program on the program call tree according to a tainted path, and setting a code refactoring rule to perform code refactoring on a method in the key module according to a special program structure.
A driving method and system for increasing the grayscale level of electrowetting electronic paper display. The method comprises: on the assumption that the maximum data bit that existing driving chips can achieve for digital-to-analog conversion is m, to achieve conversion of more bits, if a target data bit for grayscale level restoration is n, splitting data into (h+1) pieces of m-bit data + a k value, and outputting same in different subframes, wherein first m-bit data corresponds to low m-bit of n-bit data, and the value of the first m-bit data is output in a first subframe; for an ith bit in the n-bit data, i>m, if the bit is 0 or 1, correspondingly outputting 2i-m-1pieces of m-bit all-0 or all-1 data using 2i-m-1subframes; outputting grayscale level data corresponding to the k value using one subframe, combining all subframes to output (h+2) subframes to form 2n grayscale levels, so as to break through digital-to-analog conversion bit limitation of a driving chip, and achieve display of a higher grayscale. The display effect of a higher grayscale of electrowetting electronic paper can be realized by utilizing existing driving chips.
G09G 3/34 - Control arrangements or circuits, of interest only in connection with visual indicators other than cathode-ray tubes for presentation of an assembly of a number of characters, e.g. a page, by composing the assembly by combination of individual elements arranged in a matrix by control of light from an independent source
37.
ROBOT SYSTEM AND CONTROL METHOD FOR NASOTRACHEAL INTUBATION
A robot system and a control method for nasotracheal intubation are provided. The robot system for nasotracheal intubation includes an operation console and an intubation operation device arranged at a bedside end of a mobile operating bed through a passive supporting arm. The intubation operation device includes a bronchoscope and a catheter connected with the bronchoscope, a bronchoscope bending device for controlling a tip of the bronchoscope to bend, a bronchoscope rotating device for controlling the bronchoscope to rotate integrally, a bronchoscope conveying device for controlling the bronchoscope to feed and withdraw, and a roller conveying device for controlling the catheter to feed in an auxiliary way. The intubation operation device is installed on the passive supporting arm through a supporting frame, and the tip of the bronchoscope corresponds to a position of a nasal cavity of a patient on the mobile operating bed.
A61B 1/267 - Instruments for performing medical examinations of the interior of cavities or tubes of the body by visual or photographical inspection, e.g. endoscopesIlluminating arrangements therefor for the respiratory tract, e.g. laryngoscopes, bronchoscopes
A nasotracheal intubation robot system and a control method. The robot system comprises an operation console (1) and an intubation operation device (3), wherein the intubation operation device (3) is arranged at a bed head end of a movable operating bed (5) by means of a passive support arm (4); the intubation operation device (3) comprises a bronchoscope (31) and a catheter (3104) connected to the bronchoscope (31), a bronchoscope bending device (32) configured to control a tip of the bronchoscope (31) to bend, a bronchoscope rotating device (33) configured to control the bronchoscope (31) to rotate as a whole, a bronchoscope conveying device (34) configured to control the bronchoscope (31) to feed and retract, and a roller conveying device (35) configured to control the catheter (3104) to assist in feeding; the intubation operation device (3) is mounted on the passive support arm (4) by means of a support frame (36); and the tip of the bronchoscope (31) corresponds to the position of a nasal cavity of a patient placed on the movable operating bed (5). The robot system has a simple mechanism and a relatively small size and is convenient to carry and transport; and a surgeon can remotely operate an endoscope by means of a robot to complete an operation, thereby avoiding the risk of high cross infection during treatment of infectious diseases.
A61B 1/267 - Instruments for performing medical examinations of the interior of cavities or tubes of the body by visual or photographical inspection, e.g. endoscopesIlluminating arrangements therefor for the respiratory tract, e.g. laryngoscopes, bronchoscopes
A curiosity-driven Android app automatic testing method includes the following steps: 1) a left part represents a pre-processing assembly which achieves abstraction of an Android app state based on an Android interface structure; 2) a right part is curiosity-driven reinforcement learning module which maintains a historical access state set and optimizes an exploration policy constantly to guide a test to find more new states under the guidance of a reward function based on a curiosity thought; and 3) a middle part represents an advanced guidance module of a deterministic finite automaton (DFA), where the DFA is constructed during operation to record all access states and frequencies thereof; and if the new states are not explored within a given time budget, an AndroidExplore selects the most curious state as a starting point of a next exploration according to global information of the DFA.
The present invention relates to an adaptive uninstalling method for an edge environment object-oriented application which uses a function as the granularity. The method comprises: first, performing code analysis to establish a program call tree, and discovering a function call suitable for uninstalling; next, for a related function, performing code reconstruction according to a specific program structure; then, during operation, carrying out an uninstall solution decision according to the context environment, and sending the function to a plurality of remote devices in the environment for execution. The method satisfies adaptability and effectiveness of object-oriented application uninstallation, and ensures quality of service while improving the user experience of the application.
The present invention provides a curiosity-driven Android application automated testing method, comprising the following steps: 1) a preprocessing component represented by the left part implementing abstraction of an Android application state on the basis of an Android interface structure; 2) a curiosity-driven reinforcement learning module represented by the right part maintaining a historical access state set, continuously optimizing an exploration policy under the guidance of a curiosity-based reward function, and guiding a test to discover more new states; and 3) a deterministic finite automaton (DFA) advanced guidance module represented by the middle part constructing a DFA during operation, and recording all access states and frequencies thereof, and if no new state is explored in a given time budget, AndroidExplore selecting the most curious state as a starting point of the next exploration according to global information of the DFA, thereby avoiding getting stuck in local optima and improving an exploration probability of deep functions. By applying the technical solution, higher code coverage rate, fault exposure number and test efficiency can be realized.
Provided in the present invention is a method for application migration from a client-server architecture to a blockchain architecture. The method comprises step 1: modeling an application of a conventional client-server architecture, and abstracting same into a program call tree; step 2: using key data as tainted data to define a taint propagation rule for taint analysis, so as to obtain all tainted variables in a program; and step 3: according to a taint path, identifying on the program call tree a key module of the application, and setting a code refactoring rule to perform code refactoring on methods in the key module according to a specific program structure. Applying the present technical solution can effectively improve the development efficiency of a blockchain application.
G06F 16/27 - Replication, distribution or synchronisation of data between databases or within a distributed database systemDistributed database system architectures therefor
43.
LIGHT-EMITTING DISPLAY DEVICE BASED ON SPECIAL-SHAPED NLED GRAINS
A light-emitting display device based on special-shaped nLED grains comprises an upper drive electrode substrate, an upper drive electrode, special-shaped nLED grains, a lower drive electrode and a lower drive electrode substrate that are sequentially arranged from top to bottom, and is further provided with an AC drive control module having two ends connected to the upper drive electrode and the lower electrode respectively. The special-shaped nLED grains are nLED grains each comprising a non-planar luminous layer. The drive electrode is isolated from the nLED grains by insulating dielectric layer. In presence of the AC drive signal, the nLED grains are lighted up through electromagnetic coupling. By adoption of special-shaped nLED grains, when a grain sheet is disposed between the electrode substrates, the luminous layer of each nLED grain is always partially parallel to the electrode substrates and perpendicular to an electric field, thus greatly improving electrical coupling efficiency and luminous efficiency.
H01L 33/24 - SEMICONDUCTOR DEVICES NOT COVERED BY CLASS - Details thereof characterised by the semiconductor bodies with a particular shape, e.g. curved or truncated substrate of the light emitting region, e.g. non-planar junction
H01L 25/075 - Assemblies consisting of a plurality of individual semiconductor or other solid-state devices all the devices being of a type provided for in a single subclass of subclasses , , , , or , e.g. assemblies of rectifier diodes the devices not having separate containers the devices being of a type provided for in group
The invention relates to a μLED light-emitting and display device with single-ended electrical contact and single-ended carrier injection, and a manufacturing method of the μLED light-emitting and display device. The μLED light-emitting and display device comprises more than one pixel unit, and each pixel unit sequentially comprises a lower pixel electrode, μLED chips, an insulating layer, and an upper pixel electrode from bottom to top, wherein the μLED chips directly contact with the lower pixel electrode, external carriers are injected into the μLED chips through the lower pixel electrode, the insulating layer prevents the external carriers from being injected into the μLED chips through the upper pixel electrode, and the μLED chips are lit by an alternating electric field applied between the upper pixel electrode and the lower pixel electrode. The invention avoids the complicated bonding process, and is expected to improve the market competitiveness of the μLED light-emitting and display device.
H01L 33/00 - SEMICONDUCTOR DEVICES NOT COVERED BY CLASS - Details thereof
H01L 25/075 - Assemblies consisting of a plurality of individual semiconductor or other solid-state devices all the devices being of a type provided for in a single subclass of subclasses , , , , or , e.g. assemblies of rectifier diodes the devices not having separate containers the devices being of a type provided for in group
H10H 20/857 - Interconnections, e.g. lead-frames, bond wires or solder balls
A non-direct electrical contact orientation ordered nLED light-emitting display device comprises an upper drive electrode substrate, an upper drive electrode, an nLED grain sheet, a lower drive electrode and a lower drive electrode substrate that are sequentially arranged from top to bottom, and is further provided with an AC drive control module having two ends connected to the upper drive electrode and the lower drive electrode respectively. The nLED grain sheet is formed by a plurality of nLED grains that are arranged in order, so when the nLED grain sheet is disposed between the electrode substrates, a light-emitting layer of each nLED grain is parallel to the electrode substrates and perpendicular to the electric field. At least one of the upper drive electrode and the lower drive electrode is isolated from the nLED grains by an insulating dielectric layer. In presence of the AC drive signal, the nLED grains are lighted up through electromagnetic coupling. The invention adopts a non-direct electrical contact method to realize ordered nLED light-emitting display, thus omitting the transfer of a greater number of μLEDs and nLEDs and effectively reducing the process cost.
H01L 25/075 - Assemblies consisting of a plurality of individual semiconductor or other solid-state devices all the devices being of a type provided for in a single subclass of subclasses , , , , or , e.g. assemblies of rectifier diodes the devices not having separate containers the devices being of a type provided for in group
H01L 33/20 - SEMICONDUCTOR DEVICES NOT COVERED BY CLASS - Details thereof characterised by the semiconductor bodies with a particular shape, e.g. curved or truncated substrate
46.
FULL-COLOR uLED DISPLAY DEVICE WITHOUT ELECTRICAL CONTACT AND MASS TRANSFER
The present invention relates to a full-color μLED display device without electrical contact and mass transfer. The full-color μLED display device without electrical contact and mass transfer comprises a lower driving electrode disposed on a surface of a lower transparent substrate, optical micro-structures disposed on an upper surface and a lower surface of an upper transparent substrate, an upper driving electrode, a barrier micro-structure connecting the upper transparent substrate and the lower transparent substrate, a μLED crystal grain disposed in the barrier micro-structure, wavelength down-conversion light emitting layers, an insulating layer and a control module, wherein a unit R for displaying red light, a unit G for displaying green light and a unit B for displaying blue light are successively formed on the barrier micro-structure along a direction of the upper driving electrode. The upper driving electrode and the lower driving electrode are free from electrical contact with the μLED crystal grain. The control module provides an alternating driving signal and electrical coupling to lighten the μLED crystal grain so as to excite the wavelength down-conversion light emitting layers to realize full color display, so that there are no complicated manufacturing process for a three-primary-color μLED chip in a full color μLED device and complicated Bonding and mass transfer processes of a light emitting chip and a driving chip, the manufacturing period of μLED display is shortened, and the manufacturing cost is lowered.
H01L 25/075 - Assemblies consisting of a plurality of individual semiconductor or other solid-state devices all the devices being of a type provided for in a single subclass of subclasses , , , , or , e.g. assemblies of rectifier diodes the devices not having separate containers the devices being of a type provided for in group
H10K 59/95 - Assemblies of multiple devices comprising at least one organic light-emitting element wherein all light-emitting elements are organic, e.g. assembled OLED displays
47.
uLED LIGHT-EMITTING AND DISPLAY DEVICE WITHOUT ELECTRICAL CONTACT, EXTERNAL CARRIER INJECTION AND MASS TRANSFER AND PREPARATION METHOD THEREOF
The present invention relates to a μLED display design method based on nanowire. The method comprises: first, growing different nanowire materials capable of generating three primary colors: red, green and blue on a substrate; then, respectively dissolving the different nanowire materials in insulated photocuring adhesives and injecting the mixtures into different grids of a grid pool, and performing curing; and finally, arranging electrodes on upper and lower surfaces of the grid pool. The method provided by the present invention can simplify the structure and enhance the industrial efficiency of the μLED.
H01L 33/62 - Arrangements for conducting electric current to or from the semiconductor body, e.g. leadframe, wire-bond or solder balls
H01L 25/16 - Assemblies consisting of a plurality of individual semiconductor or other solid-state devices the devices being of types provided for in two or more different subclasses of , , , , or , e.g. forming hybrid circuits
H01L 33/00 - SEMICONDUCTOR DEVICES NOT COVERED BY CLASS - Details thereof
48.
TERNARY BI-IN-SN NANOALLOY MATERIAL AND LIQUID-PHASE ULTRASONIC PREPARATION METHOD THEREFOR
A ternary Bi-In-Sn nanoalloy material and a liquid-phase ultrasonic preparation method therefor, relating to the technical field of nanomaterial synthesis. The preparation method comprises the following steps: 1) mixing bismuth, indium and tin, and then performing heat treatment to obtain a bulk ternary Bi-In-Sn alloy; 2) placing the ternary Bi-In-Sn alloy into an organic solvent, heating the system, dissolving the alloy into a liquid, and performing liquid-phase ultrasonic crushing on same to obtain a ternary Bi-In-Sn nanoparticle dispersion liquid; and 3) centrifuging, washing and drying the ternary Bi-In-Sn nanoparticle dispersion liquid to prepare the ternary Bi-In-Sn nanoalloy material. The preparation method has simple operations, mild conditions, low cost and high yield. The prepared nanoalloy material has a controllable particle size and good stability, and has great application potentials in the fields of catalysis, semiconductors, biomedicine, fire prevention, etc.
B22F 9/08 - Making metallic powder or suspensions thereofApparatus or devices specially adapted therefor using physical processes starting from liquid material by casting, e.g. through sieves or in water, by atomising or spraying
B82Y 40/00 - Manufacture or treatment of nanostructures
49.
CARBON-HARD CARBON COMPOSITE MATERIAL, PREPARATION METHOD THEREFOR AND USE THEREOF
The present invention relates to the technical field of sodium ion batteries. Provided in the present invention are a carbon-hard carbon composite material, a preparation method therefor and a use thereof. The carbon-hard carbon composite material is prepared from the following raw materials in parts by mass: 80-120 parts of a porous carbon powder and 1-10 parts of a carbon material. According to the present invention, a carbon material containing N, S or P is pyrolyzed and coated on the surface of porous nano carbon to fill a carbon nanotube channel, and a rod-shaped SEI film is formed in an inner layer channel, so that the problem of sodium dendrites produced by excessive "active" sodium consumption caused by an unstable SEI film may be effectively prevented, and the overall utilization rate of the material is improved. Meanwhile, defects on the surface of the porous carbon may be modified, the contact area between an electrode and an electrolyte is reduced, the interfacial impedance is reduced, and the problem of excessive decomposition of the electrolyte is notably solved, which is beneficial to sodium ions being transmitted into the material from the electrolyte. The present invention effectively improves the first-cycle coulombic efficiency and the cycle stability, and presents a significant prospect in the commercial application of sodium-ion batteries.
SHANDONG UNIVERSITY OF SCIENCE AND TECHNOLOGY (China)
FUZHOU UNIVERSITY (China)
Inventor
Wang, Gang
Wang, Pengju
He, Peng
Wu, Xuezhen
Fan, Kerui
Wang, Changsheng
You, Zhijia
Yang, Ning
Chen, Mingrui
Zhang, Liang
Lv, Fan
Abstract
Disclosed are an underground engineering rock mass shear simulation test device, a test method and a test machine. The test method includes: setting different test conditions by a controller to perform cyclic shear test at high temperature, fracture shear seepage test, granite uniaxial compression test at high temperature and granite fracture shear test under constant normal stiffness boundary conditions at room temperature. The electric heating wire assembly, the fan assembly and the environmental box are combined to flexibly and uniformly heat the samples placed in the upper shear box and the lower shear box. In terms of shear-seepage test, this scheme proposes a second sample placing mechanism that realizes sealing through sealing capsule and sealing capsule pressing plate. It realizes stable sealing and facilitates monitoring and debugging of seepage parameters.
A fault-tolerant oriented physical design method for fully programmable valve array biochips is provided. The method comprises the following steps: step S1: constructing component placement constraints, and performing dynamic fault-tolerant placement based on a dynamic constraint placement algorithm of particle swarm optimization and in combination with dynamic fault-tolerant technology, thereby obtaining a fault-tolerant placement scheme without component conflicts; step S2: considering an input sequence of reagents and an A* fault-tolerant routing algorithm based on an optimal input sequence, performing dynamic fault-tolerant routing in combination with the dynamic fault-tolerant technology; and step S3: further processing fluid conflicts in the routing through a routing optimization strategy based on priority and backtracking, so as to obtain a fault-tolerant routing scheme without fluid conflicts.
The present invention relates to a fault-tolerance-oriented physical design method for a fully programmable valve array (FPVA) biochip. The method comprises the following steps: step S1, constructing a component layout constraint, and performing dynamic fault-tolerant layout on the basis of a dynamic constraint layout algorithm based on particle swarm optimization and in combination with a dynamic fault-tolerant technique, so as to obtain a fault-tolerant layout scheme without component conflicts; step S2, taking a reagent input sequence into consideration, and performing dynamic fault-tolerant routing on the basis of an A* fault-tolerant routing algorithm based on an optimal input sequence and in combination with the dynamic fault-tolerant technique; and step S3, on the basis of a priority-based routing optimization policy and a backtracking-based routing optimization policy, further handling fluid conflicts occurring in routing, so as to obtain a fault-tolerant layout scheme without fluid conflicts. In the present invention, a fault-tolerant FPVA architecture capable of avoiding all physical faults and potential conflicts is generated, thereby realizing a physical design solution for minimizing a biological assay completion time and the total length of a transportation path.
G06F 30/398 - Design verification or optimisation, e.g. using design rule check [DRC], layout versus schematics [LVS] or finite element methods [FEM]
G06N 3/006 - Artificial life, i.e. computing arrangements simulating life based on simulated virtual individual or collective life forms, e.g. social simulations or particle swarm optimisation [PSO]
53.
Ammonia fuel cell system capable of fast adsorption-desorption switching by self-evaporation of ammonia and power generation method thereof
FZU Zijin Hydrogen Power Technology Co., Ltd. (China)
Inventor
Jiang, Lilong
Luo, Yu
Lin, Li
You, Jiacheng
Zhang, Lixuan
Zhang, Qing
Abstract
An ammonia fuel cell system capable of rapid adsorption-and-desorption switching by ammonia self-evaporation includes an ammonia decomposition reactor; an ammonia tank; a first heat exchanger; a fuel tank; a first blower; a second heat exchanger; an adsorption column device; a fuel cell; a gas circulation system; and an exhaust gas combustion system, wherein an outlet of the ammonia tank connects with an ammonia gas inlet of the ammonia decomposition reactor, wherein a decomposition gas outlet of the ammonia decomposition reactor, through the first heat exchanger, connects with an adsorption inlet of the adsorption column device, wherein a product produced by decomposition of ammonia gas in the ammonia decomposition reactor preheats a raw ammonia gas via the first heat exchanger, wherein the fuel tank connects with the ammonia decomposition reactor for feeding a fuel gas to the ammonia decomposition reactor.
H01M 8/0606 - Combination of fuel cells with means for production of reactants or for treatment of residues with means for production of gaseous reactants
H01M 8/04082 - Arrangements for control of reactant parameters, e.g. pressure or concentration
54.
METHOD FOR SUPPORTING ADAPTIVE UNLOADING OF MULTI-INTERNET OF THINGS (IOT) APPLICATIONS IN EDGE ENVIRONMENT
A method for supporting adaptive unloading of multi-Internet of Things (IoT) applications in an edge environment includes: constructing an application compliant with a universal program structure supporting on-demand computing unloading; for the application compliant with the universal program structure supporting on-demand computing unloading, extracting a program fragment flowchart through static code analysis to provide internal flow information of the application for generation of an unloading solution; analyzing a peripheral mobile edge computing (MEC) environment and the application through an unloading solution generating algorithm based on a multi-task particle swarm optimization-genetic algorithm to obtain the optimal unloading solution; and performing, by the application, computing unloading by taking a service as a particle size according to the unloading solution to minimize a system overhead under a circumstance that a deadline constraint of each application is satisfied. The method supports the computing unloading of different types of applications in the MEC environment.
The present invention relates to a method for supporting adaptive offloading of multiple Internet of things applications in an edge environment, comprising: constructing an application program conforming to a general program structure supporting on-demand computing offloading; for the application program conforming to the general program structure supporting on-demand computing offloading, extracting a program fragment flowchart by means of static code analysis so as to provide internal flow information of the program for generation of an offloading scheme; analyzing a surrounding MEC environment and the application program by means of an offloading scheme generation algorithm of a multi-task particle swarm optimization algorithm based on a genetic algorithm operator to obtain an optimal offloading scheme; and according to the offloading scheme, the application program performing computing offloading by taking a service as the granularity, and under the condition that each application deadline constraint is met, minimizing system overhead. According to the method, computing offloading of different types of applications in an MEC environment is supported, and the system overhead generated due to computing offloading is minimized.
A coupling process for producing biodiesel from a waste FOG including: among others, 1) removing solid impurities from a waste FOG, then mixing with an alcohol and liquid acid catalyst to generate a pre-esterified mixture; 2) mixing the mixture with water, and charging the mixture to separate an aqueous phase to remove metal ions to obtain an esterification product II; 3) mixing the product II with a vulcanizator and H2 to generate a product I; 4) and separating the product I to obtain an oil phase, mixing the oil phase with H2 and passing the mixture into a fixed-bed reactor, and using a gas-liquid separator for separation to obtain an oil phase product II.
C10G 67/14 - Treatment of hydrocarbon oils by at least one hydrotreatment process and at least one process for refining in the absence of hydrogen only plural serial stages only including at least two different refining steps in the absence of hydrogen
57.
INTELLIGENT DETECTION METHOD AND SYSTEM FOR INTERNAL DEFECTS OF WOOD MEMBER WITH A RECTANGULAR SECTION
An intelligent detection method and system are provided for identify internal defects of a wood member with a rectangular section. According to the method, collected ultrasonic wave velocity data is corrected to make internal defect characteristics of the rectangular wood member more prominent. In addition, distribution of the corrected ultrasonic wave velocity data in a rectangular cross section of wood member is determined, and gradient visualization processing with red, green and blue (RGB) color is performed according to an ultrasonic wave velocity to obtain a two-dimensional (2D) detection image of a cross section of each layer in the wood member. Then, transformation from each discrete 2D detection plane to a complete three-dimensional (3D) image is performed to precisely detect whether there are defects in the rectangular wood member.
The present invention relates to a joint optimization system and method for computation offloading and resource allocation in a multi-constraint-edge environment. For a dynamic MEC system under a multi-constraint condition, a unified computation offloading and resource allocation model is designed, and the delay and energy consumption of task execution are taken as optimization objectives. A task priority preprocessing mechanism is designed, a priority can be allocated to a task according to a data volume of the task and the performance of a mobile device, and a deep-reinforcement-learning-based joint optimization method for computation offloading and resource allocation, i.e. JOA-RL, is provided; and in the JOA-RL method, a critic network uses a single-step update mode based on a value function, so as to assess the current offloading scheme and resource scheduling policy, and an actor network uses an update mode based on a policy gradient, so as to output the offloading scheme and the resource scheduling policy. The present invention has a significant effect in terms of increasing the success rate of task execution and reducing the delay and energy consumption of task execution.
The present invention relates to a deep regressive recurrent neural network-based edge prediction method, comprising the following steps: step S1: acquiring historical edge load data and constructing a data set; step S2: preprocessing the data set; step S3: using a user of an edge server as a covariate; step S4: inputting the preprocessed data set and the covariate into a prediction model, to predict a future edge load; step S5: assisting an edge computing service to formulate a resource scheduling scheme on the basis of an edge load prediction result. The present invention implements scalable and effective workload prediction, thereby effectively improving resource allocation efficiency in cloud computing.
The present disclosure relates to a construction method for a deformable anchor cable capable of being prestressed. The anchor cable includes an outer sleeve, a shrinkage pipe, an inner sleeve, a steel strand, an anchor and a tray. When the anchor cable is in use, a hole is drilled first, then the anchor cable is mounted in the drilled hole, and finally a prestress is applied to the steel strand of the anchor cable. According to the construction method, the construction is convenient; the anchor cable has the characteristics of high strength and large deformation, and can be easily prestressed; and the large deformation is realized by squeezing the inner sleeve by means of the anchor, which completely overcomes the problem of breaking a cold-drawn rod during the large deformation process.
The present invention relates to a μLED light-emitting and display device without electrical contact, external carrier injection and mass transfer and a preparation method thereof. The μLED light-emitting and display device includes one or more light-emitting pixels, and each light-emitting pixel includes a pixel lower electrode, a lower insulation layer, a μLED chip, an upper insulation layer and a pixel upper electrode from bottom to top, wherein the upper insulation layer and the lower insulation layer prevent the μLED chip from being in direct electrical contact with the pixel lower electrode and the pixel upper electrode, and the μLED chip is lit by an alternating electric field through electromagnetic coupling. In the present invention, the μLED chip is not in electrical contact with a driving electrode, such that a structure of the μLED chip may be simplified, a μLED chip array may be disposed in a manner such as ink-jet printing, screen printing, spin coating, brush coating, roll coating or chemical self-assembly, the use of a mass transfer process and a complex bonding process of the μLED chip and a driving array may be avoided, a manufacturing period of the μLED device is effectively shortened and manufacturing costs are reduced, and it is expected to enhance the market competitiveness of the μLED.
FZU Zijin Hydrogen Power Technology Co., Ltd. (China)
Fuzhou University (China)
Inventor
Jiang, Lilong
Chen, Chongqi
Luo, Yu
Ni, Jun
Zhang, Qing
Abstract
A method for preparing a supported Ru and/or Ni catalyst includes mixing a magnesium precursor, a zinc precursor, or a nickel precursor with an aluminum precursor in solid phase to form a first mixture; adding an auxiliary agent to the first mixture to form a second mixture, wherein the auxiliary agent is to increase a specific surface area; calcining the second mixture at a first temperature to obtain a spinel carrier; placing the spinel carrier in a solution of a Ru and/or Ni metal salt to impregnate the spinel carrier with the Ru and/or Ni metal salt to obtain an impregnated carrier; and after drying, calcining the impregnated carrier at a second temperature to obtain the supported Ru and/or Ni catalyst.
A method for deodorizing sludge with a metal salt and a tannin extract together, deodorized sludge, and use thereof are provided. The present invention provides a sludge deodorization technology that has high treatment efficiency, environmental friendliness, and low investment costs, and satisfies harmless requirements of subsequent resource utilization such as incineration, pyrolysis, or carbonization. Characterized by containing abundant phenolic hydroxyl groups, the tannin extract is used as a multidentate ligand to undergo a complexation reaction with metal ions, which reduces bioavailability of proteins and other macromolecules, and effectively inhibits production of low-volatile sulfides, thereby significantly deodorizing the sludge during standing and combustion. The whole deodorization process of the present invention is simple and feasible, is flexible in operation, requires no complex and harsh reaction conditions or expensive equipment, has low operating costs, and can be used as a supporting pretreatment technology for resource utilization of sludge.
The present invention provides an ultra-high resolution micro-LED display device and a metal film bonding method therefor. A driving backplane of a micro-LED display device and a micro-LED chip array are interconnected by using a metal film bonding method, and the micro-LED chip array uses high-resistance GaN as a partition and etching protection layer. One pixel of the micro-LED display device corresponds to N micro-LED light-emitting arrays or nano-LED light-emitting arrays, and N is greater than or equal to 1. By applying the present technical solution, the preparation process can be simplified, and an edge effect and size effect that may be generated during an etching process can be reduced.
H01L 25/16 - Assemblies consisting of a plurality of individual semiconductor or other solid-state devices the devices being of types provided for in two or more different subclasses of , , , , or , e.g. forming hybrid circuits
65.
MULTI-STEP FLOOD FORECASTING METHOD AND APPARATUS BASED ON GRU-SEQ2SEQ
The present invention provides a multi-step flood forecasting method and apparatus based on GRU-Seq2Seq. On the basis of a GRU model, a GRU algorithm is improved, a Seq2Seq model is introduced, measured rainfall data and simulated runoff data are together inputted into a GRU encoder to obtain an encoding vector, and then the encoding vector is inputted into a GRU decoder to obtain predicted flow. By means of a GRU-Seq2Seq flood forecasting model, rainfall runoff information under the impact of typhoons can be fully mined, an accurate multi-step-ahead flood forecasting model is established, the problem of time lag in multi-step-ahead prediction is solved, and the effect of the flood forecasting model is effectively improved.
G06Q 10/04 - Forecasting or optimisation specially adapted for administrative or management purposes, e.g. linear programming or "cutting stock problem"
66.
AMMONIA DECOMPOSITION REACTOR HAVING AMMONIA PREHEATING FUNCTION
FZU ZIJIN HYDROGEN POWER TECHNOLOGY CO., LTD. (China)
Inventor
Jiang, Lilong
Wang, Dabiao
Luo, Yu
Zhang, Qing
Chen, Chongqi
Lin, Li
Abstract
Disclosed in the present invention is an ammonia decomposition reactor having an ammonia preheating function. The reactor comprises a heat exchanger body and a reactor body; the heat exchanger body wraps the outer side of the reactor body; heat exchange tubes on the heat exchanger body are arranged in heat exchange housings; one end of each heat exchange tube is communicated with an ammonia heat exchange inlet, and the other end of the heat exchange tube is communicated with an ammonia heat exchange outlet; a heating agent inlet and a heating agent outlet on the heat exchanger body are respectively communicated with the heat exchange housings; catalyst tubes on the reactor body are arranged in a reaction housing; the ammonia heat exchange outlet on the heat exchanger body is communicated with an ammonia inlet on the reactor body; the ammonia inlet is communicated with an ammonia decomposition gas outlet by means of the catalyst tubes; and the ammonia decomposition gas outlet is communicated with the heating agent inlet on the heat exchanger body. According to the present invention, the reactor is compact in structure, high-temperature gas of an ammonia decomposition gas in the reactor is used as a heat medium of a heat exchanger, and heat is provided for ammonia for preheating, so that ammonia entering the reactor is in a high-temperature state, and the ammonia decomposition reaction in the reactor is more sufficient.
B01J 19/24 - Stationary reactors without moving elements inside
B01J 19/00 - Chemical, physical or physico-chemical processes in generalTheir relevant apparatus
H01M 8/0606 - Combination of fuel cells with means for production of reactants or for treatment of residues with means for production of gaseous reactants
67.
FUEL CELL POWER GENERATION SYSTEM AND CONTROL METHOD THEREFOR
FZU ZIJIN HYDROGEN POWER TECHNOLOGY CO., LTD. (China)
Inventor
Jiang, Lilong
Yang, Tianying
Luo, Yu
Chen, Chongqi
Lin, Li
Abstract
Disclosed are a fuel cell power generation system and a control method therefor. The system comprises an ammonia decomposition device, an ammonia removal device, a fuel cell, a first membrane humidifier, a second membrane humidifier, and a first gas-water separator, and an air compressor; the first membrane humidifier establishes communication between the ammonia decomposition device and an anode of the fuel cell, the second membrane humidifier establishes communication between the air compressor and a cathode of the fuel cell, and the air compressor feeds compressed air into the cathode of the fuel cell; a first outlet of the fuel cell is in communication with the anode of the fuel cell, a second outlet of the fuel cell is in communication with an inlet of the first gas-water separator, a first outlet of the first gas-water separator is in communication with the first membrane humidifier, and a second outlet of the first gas-water separator is in communication with the second membrane humidifier. In the present invention, water obtained on the cathode side of the fuel cell is unidirectionally sent to the first membrane humidifier on the anode side of the fuel cell by means of the first gas-water separator, the size of the system is reduced, and the problem where the membrane at the anode side of the fuel cell is prone drying out is fundamentally solved.
H01M 8/04119 - Arrangements for control of reactant parameters, e.g. pressure or concentration of gaseous reactants with simultaneous supply or evacuation of electrolyteHumidifying or dehumidifying
68.
SOIL LANDSLIDE MATRIX SUCTION TESTING METHOD AND SYSTEM BASED ON SOIL BODY CONDUCTIVITY
Fuzhou Planning & Design Research Institute Group Co., Ltd (China)
Inventor
Jian, Wenbin
Lin, Yunzhao
Xia, Chang
Chen, Ruimin
Zhong, Xin
Dou, Hongqiang
Fan, Xiufeng
Abstract
A soil landslide matrix suction testing method and system based on soil body conductivity. The method comprises: establishing a calculation formula of an unsaturated residual soil matrix suction measurement method based on soil body conductivity; acquiring actual measurement data of an unsaturated soil conductivity-moisture content curve measured by an indoor soil slope rainfall experiment; acquiring actual measurement data of an unsaturated soil moisture content-matric suction curve measured by an indoor soil slope rainfall experiment; substituting the unsaturated soil conductivity data and the unsaturated soil matrix suction data measured into the calculation formula for fitting to obtain a saturation index and fitting parameters; and substituting the saturation index and the fitting parameters obtained into the calculation formula to obtain a conductivity-matric suction model of the soil body, and substituting a conductivity of an unsaturated soil body into the conductivity-matric suction model to obtain a matric suction of the soil body.
G01N 27/04 - Investigating or analysing materials by the use of electric, electrochemical, or magnetic means by investigating impedance by investigating resistance
A DRL-based control logic design method for continuous microfluidic biochips is provided. Firstly, an integer linear programming model is for effectively solving multi-channel switching calculation to minimize the number of time slices required by the control logic. Secondly, a control logic synthesis method based on deep reinforcement learning, which uses a double deep Q network and two Boolean logic simplification techniques to find a more effective pattern allocation scheme for the control logic.
A steel-concrete composite bridge deck slab with steel tube-perfobond rib shear connectors and a method for constructing the same. The steel-concrete composite bridge deck slab structurally includes a steel bottom plate, a concrete layer, transverse perforated steel plate units provided on the steel bottom plate, steel grids arranged on upper surfaces of the transverse perforated steel plate units and longitudinal steel tubes arranged in an inserted manner on the transverse perforated steel plate units.
Fujian Expressway Technology Innovation Research Institute Co., Ltd. (China)
Inventor
Wu, Qingxiong
Chen, Kangming
Yang, Yilun
Chen, Zhiwei
Sun, Zuoxuan
Abstract
A steel-concrete composite bridge deck slab using inverted U-shaped shear connectors and a method for constructing the same. The steel-concrete composite bridge deck slab includes a bottom steel plate and a bridge deck concrete layer, wherein inverted U-shaped perforated steel plate units are arranged on an upper surface of the bottom steel plate, and bar-mat reinforcements are arranged at upper ends of the inverted U-shaped perforated steel plate units.
A deep reinforcement learning (DRL)-based control logic design method under a continuous microfluidic biochip, which aims to seek a more effective pattern allocation scheme for control logic. Firstly, an integer linear programming model for effectively solving multi-channel switching calculation is provided, so as to minimize the number of time slices required by control logic, thereby significantly improving the execution efficiency of biochemical application; and secondly, a control logic synthesis method based on DRL is provided, and by means of the method, a more effective pattern allocation scheme is sought for the control logic by using a double deep Q-network and two Boolean logic simplification techniques, thereby bringing about better logic synthesis performance and lower chip cost.
G05B 13/04 - Adaptive control systems, i.e. systems automatically adjusting themselves to have a performance which is optimum according to some preassigned criterion electric involving the use of models or simulators
73.
GROOVE-TYPE FIELD EFFECT TRANSISTOR BIOSENSOR BASED ON ATOMIC LAYER DEPOSITED SEMICONDUCTOR CHANNEL
A groove-type field effect transistor biosensor based on an atomic layer deposited semiconductor channel is provided. By utilizing the characteristics of excellent step coverage and precise control of an atomic-level film thickness of Atomic Layer Deposition, a high-k dielectric and an indium tin oxide (ITO) semiconductor are sequentially deposited on the three-dimensional groove structure to prepare the biosensor with three-dimensional groove structure field effect transistor. A device with the three-dimensional groove structure can overcome the influence of Debye Screening Effect, achieve a longer Debye length than that with a planar structure, and can detect low-concentration disease markers in high ionic strength solutions, and it has the advantages of high sensitivity and rapid detection, and shows a broad application prospect in the fields of instant detection, invitro diagnosis, biochemical analysis, etc.
The present disclosure provides a hexadeca amino- or hexadeca ammonium-modified zinc phthalocyanine and a preparation method and use thereof. In a zinc phthalocyanine structure, a 3-(dimethylamino)phenoxy substituent or a 3-(trimethylammonium) phenoxy substituent is located at peripheral positions α and β of a phthalocyanine ring. The zinc phthalocyanine complex has a high photosensitive activity and a high water solubility. The zinc phthalocyanine complex exists in the form of a monomer in water, which is conducive to exerting a photodynamic activity in water; meanwhile, the zinc phthalocyanine complex has an absorption spectrum red-shifted to 720 nm, which is located in a near-infrared region that is more conducive to penetrating human tissues. Therefore, the zinc phthalocyanine complex has higher tumor targeting ability and photodynamic tumor-suppression effect, and is scavenged quickly in vivo, which can be used for preparing a photosensitizer or a photodynamic drug or a photosensitive medicament.
A method for preparing a multifunctional hydrogel by yeast fermentation is provided. According to the present disclosure, graphene oxide is reduced by polydopamine to obtain a reduced graphene oxide solution first, and then a certain concentration of a gelatin-PCA-glucose mixed solution and an activated yeast liquid are prepared. The three solutions are uniformly mixed and stirred by a one pot reaction method, poured into a mold, and subjected to fermentation in a 30° C. water bath for a certain period of time, so as to obtain a Gel-PrGO-PCA-yeast multifunctional hydrogel material. The method is simple, convenient, rapid, and efficient. The obtained hydrogel has good air permeability, superior mechanical properties, electrical conductivity, and biocompatibility, and can be applied to different skin locations to achieve electrocardiograph and electromyographic detection.
A61B 5/259 - Means for maintaining electrode contact with the body using adhesive means, e.g. adhesive pads or tapes using conductive adhesive means, e.g. gels
A61L 26/00 - Chemical aspects of, or use of materials for, liquid bandages
A61K 9/00 - Medicinal preparations characterised by special physical form
76.
METHOD FOR HIGH GRAY LEVEL ELECTROWETTING DISPLAY DEVICE BASED ON COOPERATION OF VOLTAGE MODULATION AND TIME MODULATION
The present invention provides a method for a high gray level electrowetting display device based on cooperation of voltage modulation and time modulation. The method comprises: firstly, quantizing inputted image data into n-bit quaternary; dividing a row display period T into n sub-periods, and weighting the sub-periods; assigning four different voltage amplitudes to a display unit within a same sub-period, voltage amplitudes of the sub-periods being different and in a certain multiple relationship; and sequentially displaying all the sub-periods bit by bit within display time of the row display period T to form 4n brightness gray levels. According to the present invention, by means of the advantage of a low response speed requirement for a driving circuit and the display device by using amplitude modulation, the defect that the display quality is reduced due to the fact that the display device cannot respond to too narrow pulses when PWM modulation is used in electrowetting is overcome; moreover, by means of the advantage of easy implementation of the driving circuit by using the PWM modulation, the defect that a circuit is complex by using the amplitude modulation in electrowetting is overcome, and a display effect of a higher gray level of electrowetting electronic paper is achieved.
G09G 3/34 - Control arrangements or circuits, of interest only in connection with visual indicators other than cathode-ray tubes for presentation of an assembly of a number of characters, e.g. a page, by composing the assembly by combination of individual elements arranged in a matrix by control of light from an independent source
77.
A FULL-COLOR uLED MICRO-DISPLAY DEVICE WITHOUT ELECTRICAL CONTACT AND A MANUFACTURING METHOD THEREFOR
The present invention relates to a full-color µLED micro-display device without electrical contact and a manufacturing method therefor. The device includes a lower driving electrode and a reflective layer arranged on a surface of the lower transparent substrate, an upper driving electrode and a diffusion layer arranged on a surface of the upper transparent substrate, a wavelength down-conversion light-emitting layer and a blue µLED grain arranged between the upper and lower driving electrodes, and a control module and a color filter film; the upper and lower driving electrodes are in no electrical contact with the blue µLED grain, the control module is in an electrical contact with the upper and lower driving electrodes, and the control module provides an alternating driving signal for controlling the µLED grain to excite a first light source which is converted into a second light source after passing through the wavelength down-conversion light-emitting layer, and after passing through the reflective layer and the diffusion layer, the first and second light sources achieve the full-color µLED micro-display through the color filter film. The present invention can effectively avoid the complex process for manufacturing tricolor µLED chips in the full-color µLED device, as well as the complex bonding and mass transfer processes for the light-emitting chip and the driving chip, thereby shortening the cycle for manufacturing a µLED display, and cutting down the production cost.
H01L 25/075 - Assemblies consisting of a plurality of individual semiconductor or other solid-state devices all the devices being of a type provided for in a single subclass of subclasses , , , , or , e.g. assemblies of rectifier diodes the devices not having separate containers the devices being of a type provided for in group
H01L 33/62 - Arrangements for conducting electric current to or from the semiconductor body, e.g. leadframe, wire-bond or solder balls
The present invention relates to a support method of preset internal cable for in-situ tunnel expansion project, comprising a cable, lockset and an anchoring agent, wherein before the excavation of the newly-built tunnel, a borehole is drilled into the surrounding rock from the in-situ tunnel, and the cable is installed in the borehole and pre-stressed, so as to play a supporting role at the moment of excavation of the newly-built tunnel. The cable is fixed in the depth of the surrounding rock by the anchoring agent, and the lockset of the cable is set at the position of the excavation contour line of the newly-built tunnel inside the surrounding rock. The present invention provides a method that does not interfere with the excavation construction and can effectively support the surrounding rock of the expanded tunnel in advance. It breaks through the “excavation first and then supports” model in the previous tunnel construction, and uses the space of the in-situ tunnel for pre-support, and by applying prestress, the deformation of surrounding rock can be controlled to the maximum extent.
The disclosure provides a porous manganese-containing Fenton catalytic material and a preparation method and use thereof. The porous manganese-containing Fenton catalytic material according to the disclosure includes particles with a cluster structure and the particles with the cluster structure include a porous-structure calcium oxide and two-dimensional nanosheets of a Mn—Ca compound on a surface of the porous-structure calcium oxide.
Disclosed is an α-phase nickel hydroxide and a preparation method and use thereof. The method for preparing an α-phase nickel hydroxide comprises the following steps: subjecting a biomass calcium source to a calcination to obtain a porous calcium oxide; under a protective atmosphere, mixing the porous calcium oxide with a first methanol-ethanol solvent to obtain a calcium oxide heterogeneous solution; under a protective atmosphere, mixing the calcium oxide heterogeneous solution with a nickel source homogeneous solution to obtain a mixture, and subjecting the mixture to a coprecipitation to obtain a nickel calcium hydroxide precursor, wherein the nickel source homogeneous solution is prepared with a nickel source containing crystal water as a solute and a second methanol-ethanol solvent as a solvent; and subjecting the nickel calcium hydroxide precursor to a calcium hydroxide removal treatment to obtain the α-phase nickel hydroxide.
C30B 7/06 - Single-crystal growth from solutions using solvents which are liquid at normal temperature, e.g. aqueous solutions by evaporation of the solvent using non-aqueous solvents
C30B 7/14 - Single-crystal growth from solutions using solvents which are liquid at normal temperature, e.g. aqueous solutions the crystallising materials being formed by chemical reactions in the solution
81.
X-RAY DETECTING FILM, METHODS OF FABRICATION AND USES THEREOF
The present invention relates, in general terms, to X-ray detecting films and uses thereof. The present invention also relates to methods of fabricating the X-ray detecting films. In particular, the X-ray detecting film comprises persistent luminescent nanoparticles dispersed within a flexible polymer matrix, wherein the persistent luminescent nanoparticles are dispersed in the flexible polymer matrix at a concentration of about 0.1% to about 100%.
A catalyst for residue suspended bed hydrocracking and a preparation method and application thereof are disclosed. The catalyst is obtained by mixing a VIM or VIIIB group transition metal salt solution with a ferric salt solution, conducting parallel-flow precipitation with an alkaline solution, adding a silicon source, and then conducting aging, washing, drying, and calcination. The catalyst has a stable structure and excellent hydrogenation activity. When used in a residue suspended bed hydrocracking reaction, the yield of liquid is up to 91 wt %, the yield of gasoline and diesel oil is up to 60 wt %, and both the yield of gas and the yield of coke are low. The catalyst has a good application prospect in residue suspended bed hydroconversion process.
C10G 47/02 - Cracking of hydrocarbon oils, in the presence of hydrogen or hydrogen-generating compounds, to obtain lower boiling fractions characterised by the catalyst used
C10G 47/26 - Cracking of hydrocarbon oils, in the presence of hydrogen or hydrogen-generating compounds, to obtain lower boiling fractions with moving solid particles suspended in the oil, e.g. slurries
B01J 21/06 - Silicon, titanium, zirconium or hafniumOxides or hydroxides thereof
The present invention relates to a deep-reinforcement-learning (DRL)-based adaptive efficient resource allocation method for a cloud data center. Firstly, an operation (job scheduling) is selected by using an actor-parameterized strategy (resource allocation) and according to a score of critic (operation evaluation) evaluation; and a resource allocation strategy is then updated by means of gradient ascent, and the variance of a strategy gradient is decreased by means of an advantage function, thereby improving the training efficiency. Wide simulation experiments are performed by using real data from the Google cloud data center. Compared with two advanced DRL-based cloud resource allocation methods and five classical cloud resource allocation methods, the method in the present invention achieves better quality-of-service (QoS) in terms of delay and a job discarding rate, and has higher energy efficiency.
The present invention relates to a deep-learning-based prediction method for a high-dimensional high-variable cloud workload. The method comprises the following steps: step S1: acquiring historical workload data of a cloud data center, and performing preprocessing; step S2: on the basis of an original data set, predicting future workloads of a processor by using a deep learning algorithm, i.e. L-PAW, which integrates a top-sparse auto-encoder (TSA) and a gated recurrent unit (GRU), and transmitting a prediction result to a CSP; and step S3, the CSP determining a resource allocation strategy according to the prediction result, such that load balance is achieved in the cloud data center. The present invention implements adaptive and effective workload prediction, and effectively improves the efficiency of efficient resource allocation in cloud computing.
The invention discloses a suction cylinder exploitation device and method for marine natural gas hydrates. The exploitation device comprises an exploitation cylinder, a water pump, a sand control device, a liquid-gas filling system and the like. Through the specially-designed exploitation cylinder and mating devices thereof, the exploitation cylinder can sink below a seabed surface to exploit natural gas hydrates deep below the seabed surface and can be withdrawn. A series of problems such as high well drilling and completion cost of traditional deep-sea drilling exploitation methods, and damage, collapses and sand generation of plain concrete wellbores under the effect of formation pressure are solved, and the limitations that traditional capping depressurization methods can only exploit submarine superficial hydrates and are low in exploitation efficiency are overcome. The invention can greatly reduce the exploitation cost of natural gas hydrates deep below the seabed surface and is of great significance for commercial exploitation of marine natural gas hydrates.
Provided are a concrete member reinforcement method and a concrete reinforcement structure. The concrete reinforcement structure includes a concrete member, a first bonding body, a second bonding body, and a fiber-reinforced composite strip. At least one groove is formed on a surface of the concrete member, and a first binder is used for filling the groove to form a first bonding body. A second binder is used for being coated on the surface of the concrete member provided with the groove, as well as the top surface of the first bonding body to form a second bonding body. The fiber-reinforced composite strip is used for being pasted on a surface, far away from the first bonding body, of the second bonding body, so that the fiber-reinforced composites can be firmly combined with the concrete member and are not easy to fall off.
The present invention provides a measurement method for measuring distance and direction relationship information uncertainty caused by point position information uncertainty. The present invention comprises: a method for measuring distance and direction relationship uncertainty between a point of certainty and an uncertain point or between two uncertain points when the actual position of the uncertain point obeys, within an error circle/error ball/error hypersphere centred on an observation position of the uncertain point, a distribution delineated by a function taking the position as an independent variable. The present invention discloses a function relationship of transmission of point position information uncertainty to distance and direction information uncertainty caused by point position information uncertainty, provides more scientific, reasonable, practical and efficient measurement indexes for geographic space data consistency verification and control, and provides a more solid theoretical basis and more robust technical support for designing solutions of various problems in the related fields of land resource management and law enforcement, surface change detection and urban and rural planning and the like.
A method for preparing a transparent fluorine-free, super-lubricating and oil-proof coating includes: dissolving a sulfhydryl compound, a styrene copolymer, a low surface energy component, and a photoinitiator in an organic solvent, conducting a uniform stirring to obtain a mixture, coating the mixture onto a substrate, and conducting a curing under an ultraviolet lamp to obtain the transparent fluorine-free, super-lubricating and oil-proof coating. The coating has excellent adhesion resistance to various organic solvents with low surface tension and even liquids with high viscosity, and has excellent chemical stability and mechanical durability. The coating can be applied to various substrates such as glass, an aluminum sheet, a steel sheet, and a polymer without limitations of a use environment, maintains excellent adhesion resistance in the environment of air, oil, and water, and has wide applicability. Moreover, according to the method, various ways such as spraying, dip-coating and spin-coating can be used.
C09D 5/00 - Coating compositions, e.g. paints, varnishes or lacquers, characterised by their physical nature or the effects producedFilling pastes
B05D 1/00 - Processes for applying liquids or other fluent materials
B05D 3/06 - Pretreatment of surfaces to which liquids or other fluent materials are to be appliedAfter-treatment of applied coatings, e.g. intermediate treating of an applied coating preparatory to subsequent applications of liquids or other fluent materials by exposure to radiation
Disclosed is a broad-spectrum antibacterial peptide CA-1 having an amino acid sequence of GLLSVLGSVAKHVLPHVVPVIAEHLWKKLFKK-NH2. The broad-spectrum antibacterial peptide is obtained by modifying, by means of a rational molecular design in combination with existing antibacterial peptide-related theoretical knowledge, a natural antibacterial peptide Caerin 1.1 derived from an Australian tree frog. Results of an antibacterial experiment indicate that the antibacterial peptide CA-1 has a broad-spectrum antibacterial effect, exhibiting a good inhibitory effect on both gram-positive bacteria and gram-negative bacteria with an inhibitory concentration that can reach 1-8 μg/mL. As determined by circular dichroism spectroscopy, the antibacterial peptide CA-1 has a negative absorption peak at 205-220 nm and can form an α-helical structure in a TFE solution.
C07K 14/46 - Peptides having more than 20 amino acidsGastrinsSomatostatinsMelanotropinsDerivatives thereof from animalsPeptides having more than 20 amino acidsGastrinsSomatostatinsMelanotropinsDerivatives thereof from humans from vertebrates
A61K 38/17 - Peptides having more than 20 amino acidsGastrinsSomatostatinsMelanotropinsDerivatives thereof from animalsPeptides having more than 20 amino acidsGastrinsSomatostatinsMelanotropinsDerivatives thereof from humans
The present invention relates to an integrated flux linkage closed-loop control system of a monostable permanent magnet contactor, comprising an integrated driving circuit and a flux linkage closed-loop control system. The integrated driving circuit comprises a rectifier bridge, a filter capacitor, integrated chips U1 and U2, a driving permanent magnet contactor coil, and multiple capacitors and resistors; the rectifier bridge and filter capacitor rectify an alternating current input voltage into a smooth direct current; the chips U1 and U2 constitute a full bridge circuit; the flux linkage closed-loop control system uses constant flux linkage closed-loop control in the starting process of the permanent magnet contactor, such that the operating power is minimized, and the flux is automatically weakened, so as to save the energy and inhibit the contact bounce; and constant zero flux linkage control is used in the breaking process, such that an electromagnetic chain completely counteracts a permanent magnet chain all the time, so as to improve the opening speed, thereby further improving the opening and closing performance of a permanent magnet switch. The system is beneficial to simplifying a hardware control circuit of the monostable permanent magnet contactor and improving the operation reliability and the opening and closing performance of the monostable permanent magnet contactor.
H01H 47/22 - Circuit arrangements not adapted to a particular application of the relay and designed to obtain desired operating characteristics or to provide energising current for supplying energising current for relay coil
91.
LOW-POWER-CONSUMPTION CAPACITOR ARRAY FOR SENSOR AND SWITCHING METHOD THEREFOR
The present invention relates to a low-power-consumption capacitor array for a sensor, and a switching method therefor, comprising: a first capacitor array, a second capacitor array, a third capacitor array, a fourth capacitor array, a comparator CMP1, a comparator CMP2, four sampling switches, four level-switching switch groups and digital logic. In the present invention, by means of the overall array design and in combination with a capacitor splitting and combination scheme, sampling is realized, and a highest bit and a next-highest bit are compared without consuming energy.
H03M 1/46 - Analogue value compared with reference values sequentially only, e.g. successive approximation type with digital/analogue converter for supplying reference values to converter
92.
HIGH-LINEARITY BOOTSTRAPPED SWITCH CIRCUIT FOR SENSOR, AND CONTROL METHOD THEREFOR
A high-linearity bootstrapped switch circuit for a sensor, comprising a transistor M1, nine switches S1, S2, S3, S4, S5, S6, S7, S8, and S9, a bootstrap capacitor C1, and a compensation capacitor Cc; the circuit comprises two working stages, i.e., a sampling stage and a holding stage. Compared with a traditional bootstrapped switch circuit, the switches S7, S8, and S9 and the non-linear compensation capacitor are added to the circuit, so that input-related non-linear terms introduced by parasitic capacitance at nodes A and B are compensated, thereby greatly improving the linearity of bootstrapped switches.
H03K 17/687 - Electronic switching or gating, i.e. not by contact-making and -breaking characterised by the use of specified components by the use, as active elements, of semiconductor devices the devices being field-effect transistors
93.
ELECTRICAL CONTACT-FREE uLED LIGHT EMITTING DEVICE BASED ON WAVELENGHT DOWN-CONVERSION
The present invention relates to a μLED light emitting device without electrical contact based on a wavelength down-conversion. The μLED light emitting device without electrical contact comprises μLED crystal grains, wavelength down-conversion light emitting lavers, ate upper driving electrode and a lower driving electrode, insulators, an optical micro-structure and a control module. The upper driving electrode and the lower driving electrode are free from direct electrical contact with each of the μLED crystal grains, the control module is electrically connected with the upper driving electrode and the lower driving electrode respectively to provide alternating driving signals to the upper driving electrode and the lower driving electrode so as to form a driving electric field, and the driving electric field controls an electron-hole recombination of the μLED crystal grain and emits a first light source which is converted into a second light source via the wavelength down-conversion light emitting layer. As a driving electrode in the μLED light emitting device without electrical contact based on the wavelength down-conversion provided by the present invention is free from electrical contact with a p-type semiconductor layer and an n-type semiconductor layer in the μLED crystal grain, there are no complicated manufacturing process of a chip in the μLED light emitting device and bonding and mass transfer processes of the μLED chip and a driving chip, so that the production cycle of the μLED light emitting device is shortened effectively and the manufacturing cost of the μLED light emitting device is reduced effectively.
The present invention relates to the technical field of molecular sieves, in particular to a single-crystal hierarchical pore HZSM-5 molecular sieve and an environment-friendly preparation method thereof. The environment-friendly preparation method of the single-crystal hierarchical pore HZSM-5 molecular sieve includes the following steps: preparing a sample by a hydrothermal method with nitrogen-free polyketal as a template agent; and conducting acid treatment on the obtained sample to remove the template agent and to obtain the single-crystal hierarchical pore HZSM-5 molecular sieve. A mesopore diameter of the single-crystal hierarchical pore HZSM-5 molecular sieve is concentrated at 10 to 40 nm, a crystal grain size thereof is 30 to 500 nm, a specific surface area thereof is 360 to 450 m2/g, and a pore volume thereof is 0.32 to 0.42 cm3/g. The present application can not only solve the problems such as collapse of a molecular sieve structure caused by high-temperature roasting, emission of harmful gases and non-recyclability of the template agent, but also can shorten a preparation process of the HZSM-5 molecular sieve and reduce energy consumption and material consumption of the process; and the synthesized HZSM-5 molecular sieve has single-crystal hierarchical pores, and has the advantages of hydrothermal stability, high specific surface area, high pore volume and the like.
The present invention relates to the technical field of molecular sieves, in particular to a neutral polymer-oriented hierarchical pore Beta molecular sieve and an environment-friendly preparation method thereof. The environment-friendly preparation method of the neutral polymer-oriented hierarchical pore Beta molecular sieve includes the following steps: preparing a sample by a hydrothermal method with nitrogen-free polyketal as a template agent; and conducting acid treatment on the obtained sample to remove the template agent and to obtain the hierarchical pore Beta molecular sieve. The hierarchical pore Beta molecular sieve is a nano-mesoporous molecular sieve, a mesopore diameter thereof is concentrated at 10 to 20 nm, a crystal grain size thereof is 30 to 120 nm, a specific surface area thereof is 700 to 820 m2/g, and a pore volume thereof is 0.75 to 0.92 cm3/g. The present application can solve the problems such as collapse of a molecular sieve structure caused by high-temperature roasting, emission of harmful gases and non-recyclability of the template agent. Moreover, the prepared Beta molecular sieve is a hierarchical pore molecular sieve, and has the advantages of nano-single crystal structure, high specific surface area, high pore volume and the like.
C01B 39/04 - Crystalline aluminosilicate zeolitesIsomorphous compounds thereofDirect preparation thereofPreparation thereof starting from a reaction mixture containing a crystalline zeolite of another type, or from preformed reactantsAfter-treatment thereof using at least one organic template directing agent, e.g. an ionic quaternary ammonium compound or an aminated compound
96.
UHPC material for reinforcing existing stone masonry wall and reinforcing method thereof
A functional active aluminosilicate, and a preparation method therefor and the use thereof. The method comprises: mixing and beating a natural silicon-aluminum mineral, an organic acid salt and an alkali metal hydroxide solution, and then respectively depolymerizing and carbonizing the natural silicon-aluminum mineral and the organic acid salt in the slurry in a spray dryer. The prepared aluminosilicate can be used for the synthesis of a hierarchical-pore molecular sieve, wherein a high-activity silicon-aluminum species contained therein provides a silicon-aluminum source for the synthesis of the hierarchical-pore molecular sieve, and carbon particles contained therein serve as a mesoporous template agent for the synthesis of the hierarchical-pore molecular sieve. The method obviously shortens the depolymerization time of the natural silicon-aluminum mineral, can achieve continuous depolymerization of the natural silicon-aluminum mineral, and is beneficial for large-scale production; moreover, carbon particles in the prepared material are highly dispersed in the active aluminosilicate, such that the problem that a carbon material is prone to undergoing phase separation from a silicon-aluminum raw material when serving as a mesoporous template agent for synthesizing the molecular sieve is effectively avoided, and an efficient and feasible method is provided for synthesizing a hierarchical-pore molecular sieve.
C01B 39/02 - Crystalline aluminosilicate zeolitesIsomorphous compounds thereofDirect preparation thereofPreparation thereof starting from a reaction mixture containing a crystalline zeolite of another type, or from preformed reactantsAfter-treatment thereof
B01J 29/08 - Crystalline aluminosilicate zeolitesIsomorphous compounds thereof of the faujasite type, e.g. type X or Y
B01J 29/40 - Crystalline aluminosilicate zeolitesIsomorphous compounds thereof of the pentasil type, e.g. types ZSM-5, ZSM-8 or ZSM-11
B01J 29/50 - Crystalline aluminosilicate zeolitesIsomorphous compounds thereof of the erionite or offretite type, e.g. zeolite T
B01J 29/70 - Crystalline aluminosilicate zeolitesIsomorphous compounds thereof of types characterised by their specific structure not provided for in groups
98.
METHOD FOR CONTROLLING THREE-PHASE REACTIVE COMPENSATOR ON BASIS OF DOUBLE PREDICTIVE CONTROL
The present invention relates to a method for controlling a three-phase reactive compensator on the basis of double predictive control. A three-phase reactive compensator is controlled according to the following steps: (1) sampling the current direct-current-side voltage Udc, and calculating the current required reference current Id_ref by means of a voltage prediction formula; (2) setting a required reactive current reference value Iq_ref, performing coordinate transformation on an active/reactive reference current, so as to obtain a current reference value under an αβ coordinate system, also sampling a three-phase power grid current on a power grid side, substituting same into a current model predictive control calculation formula, substituting the formula into a cost function, and searching for an optimal switching vector; and (3) making the optimal switching vector act on an inverter, so as to obtain a real current close to the reference current value, and then completing the control process. By means of the method, a PI parameter setting process of double closed-loop control can be avoided, and the overall dynamic response speed of a system can also be accelerated.
A blood glucose biosensor for detecting a COVID-19 antibody, the blood glucose biosensor comprising the following components: a novel coronavirus COVID-19 antigen (12), a novel coronavirus COVID-19 antibody (14), a novel coronavirus COVID-19 secondary antibody (15) modified with a hairpin structure DNA fragment H1-DNA, a trigger DNA fragment T-DNA (16), an enzyme-labeled hairpin structure DNA fragment H2-DNA (18) and a blood glucose biosensor (113). A novel coronavirus antigen-COVID-19 IgG/IgM-(H1-DNA-H2-DNA complex) sandwich structure is constructed by the biosensor; a saccharide substrate (111) is converted into glucose (112) by an enzyme (110) labeled on H2-DNA in the sandwich structure; and the glucose (112) solution is dropwise added to the blood glucose biosensor (113) to detect the amount of the glucose (112), so that the content of COVID-19 IgG/IgM is detected.
G01N 33/569 - ImmunoassayBiospecific binding assayMaterials therefor for microorganisms, e.g. protozoa, bacteria, viruses
C12Q 1/6804 - Nucleic acid analysis using immunogens
C12Q 1/54 - Measuring or testing processes involving enzymes, nucleic acids or microorganismsCompositions thereforProcesses of preparing such compositions involving glucose or galactose
C12N 15/11 - DNA or RNA fragmentsModified forms thereof
100.
Accurate control method of visual stimuli for brain-computer interface
Disclosed is an accurate control method of visual stimuli for a brain-computer interface. It is a common approach for brain-computer interfaces to evoke specific EEG signal patterns by visual stimuli and recognize the EEG signal patterns in real time. However, due to the influence of process scheduling, a process showing the visual stimuli may sometimes be dispatched out of a CPU, leading to the difficulty in guaranteeing the accuracy of the visual stimuli and the recognition effect of the EEG signal patterns. The invention designs a control method to support accurate visual stimuli of a brain-computer interface. A software system implementing the method comprises a generator, an actuator and a controller. The generator automatically generates an image sequence according to test requirements. The actuator is a module running on a GPU. At the beginning of a trail, the controller asynchronously calls an interface of the actuator to start the actuator, and the actuator accurately shows the image sequence generated by the generator. At the end of the trail, the controller asynchronously calls an interface of the actuator to stop showing visual stimuli.