The present invention concerns a method for calculating one or more isovists of a physical or extended reality environment, comprising the steps of: providing at least one electronic acquisition apparatus configured to obtain a plurality of georeferenced and physiological, and/or psychological, and/or environmental, and/or perceptual and/or demographic data, and to take a frame of the physical or extended reality environment, detect physiological variations and/or environmental variations; calculating a behaviour indicator comprising at least one positioning parameter for each user from the georeferenced data acquired by means of electronic acquisition apparatus; calculating a perception indicator comprising at least one or more physiological and/or environmental parameters for each user by means of electronic acquisition apparatus; providing a relationship identifying algorithm; identifying for each user one or more statistically significant physiological and/or environmental parameters by means of the relationship identifying algorithm by identifying a relationship between the positioning parameter and the aforesaid physiological and/or environmental parameters; associating for each user the positioning parameter with the identified, statistically significant parameters to define respective data units; defining a positioning threshold and a physiological and/or environmental threshold; grouping into respective experience sets data units having respective statistically significant physiological and/or environmental parameters differing from each other by a value lower than the respective threshold and respective positioning parameters differing from each other by a value lower than the positioning threshold, calculating at least one isovist for each experience set; representing each isovist calculated in a graphic interface of an electronic display apparatus.
FONDAZIONE IRCCS "CA' GRANDA - OSPEDALE MAGGIORE POLICLINICO" (Italy)
Inventor
Carandina, Angelica
Montano, Nicola
Scatà, Costanza
Asnaghi, Riccardo
Tobaldini, Eleonora
Bellocchi, Chiara
Abstract
The present invention relates to a system for the transcutaneous auricular vagus nerve stimulation of a patient. The system comprises an abdominal sensor, a control unit and an auricular device, connected to each other. The abdominal sensor detects diaphragmatic activity and provides the control unit with a signal representative of the patient's diaphragmatic activity. The control unit processes the signal received from the abdominal sensor and controls the auricular device on the basis of the diaphragmatic activity. The auricular device emits pulses on command of the control unit; it comprises two stimulating electrodes that, in use, maintain contact with the upper and lower concha of the patient's auricle. The control unit controls the auricular device in such a way that it emits a series of bi-phase pulses during the diaphragm relaxation phase, wherein the series has a frequency comprised between 1 Hz and 200 Hz, the bi-phase pulses have a duration between 100 μs and 1000 μs and a current intensity between 0.1 mA and 5.0 mA.
Disclosed is a method for evaluation of residual platelet thrombotic potential in a patientundergoing antiplatelet therapy with acetylsalicylic acid which comprises determination ofplatelet tissue factor (TF) expression in a patient's blood sample.
FONDAZIONE ISTITUTO ITALIANO DI TECNOLOGIA (Italy)
SCUOLA SUPERIORE DI STUDI UNIVERSITARI E PERFEZIONAMENTO SANT'ANNA (Italy)
Inventor
Ciana, Paolo
Brunialti, Electra
Villa, Alessandro Maria Giovanni
Reggiani, Angelo
Lionetti, Vincenzo
Abstract
Novel compounds capable of blocking viral infections sustained by the SARS-Cov2 virus are provided. A method for preventing and/or treating infectious diseases caused by a virus involving administering the novel compounds is also provided.
A method for diagnosing neurodegenerative diseases, the method including measuring the JNK3 levels in a biological sample selected from plasma, CSF, and saliva. The method also includes measuring P-JNK3.
The present invention relates to a method of prognosis of a subject affected by breast cancer comprising determining the expression level of one or more genes in an isolated sample from said subject and to kits for performing said method.
C12Q 1/6886 - Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes for diseases caused by alterations of genetic material for cancer
7.
2 FROM THE ATMOSPHERE, AND METHOD FOR MANUFACTURING IT
B01J 20/02 - Solid sorbent compositions or filter aid compositionsSorbents for chromatographyProcesses for preparing, regenerating or reactivating thereof comprising inorganic material
B01J 20/04 - Solid sorbent compositions or filter aid compositionsSorbents for chromatographyProcesses for preparing, regenerating or reactivating thereof comprising inorganic material comprising compounds of alkali metals, alkaline earth metals or magnesium
B01J 20/10 - Solid sorbent compositions or filter aid compositionsSorbents for chromatographyProcesses for preparing, regenerating or reactivating thereof comprising inorganic material comprising silica or silicate
H01J 37/34 - Gas-filled discharge tubes operating with cathodic sputtering
B01D 53/02 - Separation of gases or vapoursRecovering vapours of volatile solvents from gasesChemical or biological purification of waste gases, e.g. engine exhaust gases, smoke, fumes, flue gases or aerosols by adsorption, e.g. preparative gas chromatography
The present invention relates to an in vitro method for enhancing the ability of urease-positive or urease-negative bacterial cells to more efficiently consume the lactose present in the environment in which they are located. The present invention further relates to bacterial cells obtained with this method, a food product and a food supplement comprising them, as well as the use thereof.
It is an object of the present invention to provide a non-therapeutic method for treating skin aging and hyperpigmentation, wherein the method comprises the administration of a cosmetic composition comprising one or more peptides.
Kit (100) comprising a preparation solution (17) configured to prepare a compound to be analysed, a sensor (1) for the determination of gluten contamination in the compound, and a processing unit connected thereto. The sensor comprises a base layer (2) with a pair of electrodes (2a); an upper layer (4) with a membrane (4a) permeable to at least one gas releasable by the compound as a function of the concentration of at least one prolamin present in the compound; and a resistive layer (3), interposed between the base layer (2) and the upper layer (4) and configured to detect the gas released by the compound and permeated through the membrane (4a) and to change the resistivity thereof as a function of the gas detected. The pair of electrodes (2a) is configured to detect a resistivity change in the resistive layer (3) and to generate a signal as a function of the detected resistivity change.
G01N 27/12 - Investigating or analysing materials by the use of electric, electrochemical, or magnetic means by investigating impedance by investigating resistance of a solid body in dependence upon absorption of a fluidInvestigating or analysing materials by the use of electric, electrochemical, or magnetic means by investigating impedance by investigating resistance of a solid body in dependence upon reaction with a fluid
G01N 33/00 - Investigating or analysing materials by specific methods not covered by groups
11.
ALLOPLASTIC AURICLE PROSTHESIS AND METHOD FOR MANUFACTURING THE SAME
FONDAZIONE IRCCS CA' GRANDA - OSPEDALE MAGGIORE POLICLINICO (Italy)
Inventor
Fare', Silvia
Capotorto, Elena
Chiudaroli, Licia
Beltramini, Giada Anna
Montrasio, Edoardo Francesco
Abstract
The invention relates to an alloplastic prosthesis (20) for the complete or partial reconstruction of the outer ear (22) of a patient (24). The alloplastic prosthesis comprises a plurality of shaped layers (26) stacked and joined to each other, wherein some layers are made of thermoplastic polyurethane (TPU) and other layers are made of polycaprolactone (PCL); at least the outer surface of the alloplastic prosthesis comprises a plurality of pores (28) having a predefined structure and surface comprised between 0.1 mm2and 0.2 mm2. The invention further relates to a method (100) for manufacturing the alloplastic prosthesis.
A61F 2/00 - Filters implantable into blood vesselsProstheses, i.e. artificial substitutes or replacements for parts of the bodyAppliances for connecting them with the bodyDevices providing patency to, or preventing collapsing of, tubular structures of the body, e.g. stents
12.
ANTIMICROBIAL PEPTIDES FOR THE CONTAINMENT OF OOMYCETES IN AGRICULTURE
The present invention relates to novel antimicrobial peptides for use as a viable and sustainable alternative to fungicides currently used in agriculture against infection by oomycetes infection, and related methods for protecting crops.
The present invention relates to a polypeptide which is a temperature-modulated ion channel, wherein said ion channel is a channel comprising four subunits which associate to form a homo- or hetero-tetramer, preferably is a potassium channel, wherein said polypeptide comprises at least one peptide comprising at least one portion of one of said subunits and a portion of the cytoplasmic C-terminal domain of the bacterial voltage-gated sodium channel BacNav, wherein said portion comprises at least one mutation in one of the amino acids in position 267, 271 or 274, wherein said numbering is read with reference to the voltage-gated sodium channel BacNav, SEQ ID NO: 5. The present invention further relates to the use of said polypeptide in the treatment of a condition modulated by potassium channel activity, selected from the group comprising: neuromyotonia, episodic ataxia type 1, hereditary deafness syndromes, benign familial neonatal seizures and periodic hypokalemic paralysis, neuropathic pain, diabetic neuropathic pain, trauma (thoracic surgery), glioblastoma, skin diseases, in particular originating from keratinocyte dysfunctions.
The present invention relates to inhibitors of TMED2-DT expression, in particular inhibitors of TMED2-DT expression selected from the group consisting of antisense oligonucleotide (ASO), RNAi agent and ribozyme. The invention further relates to use of TMED2-DT expression inhibitors for the treatment of cancer.
The present invention relates to a process for depolymerizing plastic waste containing semi-aromatic polyesters, and in particular polyethylene terephthalate (PET), through methanolysis, for the production of dimethyl terephthalate (DMT). In particular, the invention relates to a process for depolymerizing plastic waste containing terephthalic polyesters, and in particular polyethylene terephthalate (PET), comprising the following steps: a) subjecting a plastic material containing terephthalic polyesters, in particular PET, to a methanolysis process in the presence of methanol and a catalyst based on a quaternary ammonium ionic compound and an iron(III), manganese(II), or cobalt(II) halide; b) separating the solid residue of step a) containing dimethyl terephthalate (DMT) from the liquid phase containing methanol, a glycol and the catalyst in solution; c) separating the DMT in substantially pure form from the solid residue of step b); d) optionally, subjecting the liquid phase of step b) to fractional distillation to recover the methanol, the glycol and the catalyst.
A method for optically computing a Boolean function with M inputs and related electro-optical computing system are provided. The system has a coherent or partially coherent light radiation source making M input light beams available, an optical modulation device generating modulated light beams, one or more light-diffusing devices receiving the modulated light beams, at least one electronic processing unit controlling the optical modulation device, and one or more electro-optical sensors. The method involves generating modulated light beams, making the modulated light beams available to the one or more light-diffusing devices to generate 2M random or pseudo-random fields, deriving 2M Boolean fields, each Boolean field including first points of an observation space representative of a logical 1, second points of the observation space representative of a logical 0, selecting a target Boolean function with M inputs, identifying active points between the first and second points that satisfy the selected target Boolean function, and computing the Boolean function.
COMMISSARIAT A L’ÉNERGIE ATOMIQUE ET AUX ÉNERGIES ALTERNATIVES (France)
CENTRE NATIONAL DE LA RECHERCHE SCIENTIFIQUE (France)
Inventor
Bernardi, Anna
Pollastri, Sara
Delaunay, Clara
Thépaut, Michel
Fieschi, Franck
Cavazzoli, Gianluca
Abstract
The present invention relates to new glycomimetic molecules which selectively bind to the L-SIGN receptor, finding application in the medical field and, in particular, in the prevention and treatment of viral infections, in the immunotherapy of liver tumors and in the treatment of immune diseases.
A61K 31/7056 - Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing five-membered rings with nitrogen as a ring hetero atom
A61K 31/7064 - Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom containing condensed or non-condensed pyrimidines
18.
MANUFACTURE OF POLYHYDROXYLAMINE VIA ELECTROLYSIS OF SUBSTRATES
3636366-polyhydroxylketone with hydroxylamine or ions thereof, or with ammonia or ions thereof, and by subsequently electrolyzing the solution obtained in the previous step.
A test bench assembly (10) for the simulation of cardiac surgery and/or interventional cardiology operations and/or procedures, comprising a passive heart (12), wherein said passive heart (12) is an explanted or artificial or hybrid heart, said passive heart (12) having at least one pair of cardiac chambers (14, 16; 114, 116) comprising an atrial chamber (14; 114) and a ventricular chamber (16; 116); a reservoir (20), adapted to house the working fluid; a pressure generator (22), adapted to provide said passive heart (12) pumping said working fluid with the pumping function, said pressure generator (22) being fluidically connected both to said ventricular chamber (16) of said passive heart (12) and to said reservoir (20) by means of first fluid connection means; a pressure regulation device (24) which provides the working fluid in input to the atrial chamber (14) with the preload pressure, and the working fluid in output from the ventricular chamber (16) with the afterload pressure, said pressure regulation device (24) being fluidically connected both to said atrial chamber (14) of said passive heart (12) and to said ventricular chamber (16) of said passive heart (12) by means of second fluid connection means; wherein said pressure regulation device (24) comprises a single compliant element (26) for each pair of cardiac chambers (14, 16) which provides the working fluid with both the preload and the afterload pressures.
Nanoconstructs consisting of a core and a lipid coating, suitable for conveying therapeutic and diagnostic (or "theranostic") agents to target tissues or organs, delivering them to the cells of interest where the nanoparticle load is released, are described. A further aspect of the invention concerns diagnostic, therapeutic or theranostic compositions comprising coated nanoparticles together with pharmaceutically acceptable vehicles or excipients.
A61K 31/704 - Compounds having saccharide radicals attached to non-saccharide compounds by glycosidic linkages attached to a carbocyclic compound, e.g. phloridzin attached to a condensed carbocyclic ring system, e.g. sennosides, thiocolchicosides, escin, daunorubicin, digitoxin
A61K 9/1271 - Non-conventional liposomes, e.g. PEGylated liposomes or liposomes coated or grafted with polymers
21.
PROCESS FOR THE PREPARATION OF THE CUTIN- BASED MATERIAL AND BIOMEDICAL APPLICATIONS THEREOF
The present invention relates to a process for the preparation of a biopolymer obtained from the cutin contained in tomato skin and the applications thereof for the production of biomedical devices and products for personal hygiene.
D01F 6/62 - Monocomponent man-made filaments or the like of synthetic polymersManufacture thereof from homopolycondensation products from polyesters
D01F 6/92 - Monocomponent man-made filaments or the like of synthetic polymersManufacture thereof from mixtures of polycondensation products as major constituent with other polymers or low-molecular-weight compounds of polyesters
C08G 63/06 - Polyesters derived from hydroxy carboxylic acids or from polycarboxylic acids and polyhydroxy compounds derived from hydroxy carboxylic acids
The invention relates to pharmaceutical dosage forms comprising a drug having a fast absorption in the gut, which is absorbed in distal intestinal tract including the colon, and for which pulsatile release is necessary to avoid the potential toxicity of the drug continuous absorption. In particular the invention is directed to a dosage form comprising a formulation in form of coated small units to deliver the active ingredient after a programmed time period following oral administration and processes of preparation thereof. In a preferred embodiment the drug is the iron chelator deferiprone.
Described herein is a container (1) for a radiation detector (2), comprising a cover (4) made of electrically insulating, non-abrasive, non-rigid and elastically deformable material. Said cover (4) is fixed to a housing portion (3) configured to house the radiation detector (2), so as to protect it from impurities by forming an airtight chamber (5).
The present patent application describes the so-called "organic" compositions for preventing the development of fungal functions in crop plants, and in particular, in hydroponically grown plants.
A01N 37/40 - Biocides, pest repellants or attractants, or plant growth regulators containing organic compounds containing a carbon atom having three bonds to hetero atoms with at the most two bonds to halogen, e.g. carboxylic acids containing at least one carboxylic group or a thio-analogue, or a derivative thereof, and a singly bound oxygen or sulfur atom attached to the same carbon skeleton, this oxygen or sulfur atom not being a member of a carboxylic group or of a thio-analogue, or of a derivative thereof, e.g. hydroxy-carboxylic acids having at least one oxygen or sulfur atom attached to an aromatic ring system having at least one carboxylic group or a thio-analogue, or a derivative thereof, and one oxygen or sulfur atom attached to the same aromatic ring system
The present invention relates to a method for calculating one or more isovists of a physical or extended reality environment, comprising the following steps: providing at least one electronic acquisition device configured to obtain a plurality of georeferenced data, such as time, position, orientation, and configured to take frames of the physical or extended reality environment; calculating a positioning parameter for each user, each positioning parameter being representative of a positioning point of a respective user in the physical or extended reality environment and being determined from the georeferenced position data acquired when said respective user uses the electronic acquisition device to take a frame of the physical or extended reality environment; calculating an aim parameter for each user, each aim parameter being representative of the direction of a respective frame of the physical or extended reality environment taken by a user at the respective positioning point and being calculated from the georeferenced orientation data acquired when such respective user uses the electronic acquisition device to take the frame; associating each positioning parameter with a respective aim parameter to define respective data units; grouping into respective positioning sets data units having respective positioning parameters differing from each other by a value lower than a positioning threshold value and respective aim parameters differing from each other by a value lower than an aim threshold value; calculating at least one isovist for each positioning set as a function of the respective positioning and/or aim parameters; representing each calculated isovist in a graphical user interface of an electronic display device.
G06F 3/01 - Input arrangements or combined input and output arrangements for interaction between user and computer
G06F 3/0338 - Pointing devices displaced or positioned by the userAccessories therefor with detection of limited linear or angular displacement of an operating part of the device from a neutral position, e.g. isotonic or isometric joysticks
26.
COMBINATIONAL THERAPY OF LSD1 INHIBITORS WITH P21 ACTIVATORS IN THE TREATMENT OF CANCER
The present disclosure relates to methods of treating cancer and pharmaceutical compositions for use in the treatment of cancer, including LSD1-inhibitor-resistant cancers, comprising administering to a subject an effective amount of a cell cycle inhibitor, such as a CDK4/6 inhibitor or a p21 enhancer, and an effective amount of a LSD1 inhibitor.
A61K 31/519 - PyrimidinesHydrogenated pyrimidines, e.g. trimethoprim ortho- or peri-condensed with heterocyclic rings
A61K 31/135 - Amines, e.g. amantadine having aromatic rings, e.g. methadone
A61K 31/165 - Amides, e.g. hydroxamic acids having aromatic rings, e.g. colchicine, atenolol, progabide
A61K 31/167 - Amides, e.g. hydroxamic acids having aromatic rings, e.g. colchicine, atenolol, progabide having the nitrogen atom of a carboxamide group directly attached to the aromatic ring, e.g. lidocaine, paracetamol
A61K 31/325 - Carbamic acidsThiocarbamic acidsAnhydrides or salts thereof
A61K 31/343 - Heterocyclic compounds having oxygen as the only ring hetero atom, e.g. fungichromin having five-membered rings with one oxygen as the only ring hetero atom, e.g. isosorbide condensed with a carbocyclic ring, e.g. coumaran, bufuralol, befunolol, clobenfurol, amiodarone
A61K 31/366 - Lactones having six-membered rings, e.g. delta-lactones
A61K 31/4025 - Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having five-membered rings with one nitrogen as the only ring hetero atom, e.g. sulpiride, succinimide, tolmetin, buflomedil not condensed and containing further heterocyclic rings, e.g. cromakalim
A61K 31/4045 - Indole-alkylaminesAmides thereof, e.g. serotonin, melatonin
A61K 31/407 - Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having five-membered rings with one nitrogen as the only ring hetero atom, e.g. sulpiride, succinimide, tolmetin, buflomedil condensed with heterocyclic ring systems, e.g. ketorolac, physostigmine
A61K 31/4155 - 1,2-Diazoles not condensed and containing further heterocyclic rings
A61K 31/4184 - 1,3-Diazoles condensed with carbocyclic rings, e.g. benzimidazoles
A61K 31/437 - Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with one nitrogen as the only ring hetero atom ortho- or peri-condensed with heterocyclic ring systems the heterocyclic ring system containing a five-membered ring having nitrogen as a ring hetero atom, e.g. indolizine, beta-carboline
A61K 31/4406 - Non-condensed pyridinesHydrogenated derivatives thereof only substituted in position 3, e.g. zimeldine
A61K 31/4439 - Non-condensed pyridinesHydrogenated derivatives thereof containing further heterocyclic ring systems containing a five-membered ring with nitrogen as a ring hetero atom, e.g. omeprazole
A61K 31/445 - Non-condensed piperidines, e.g. piperocaine
A61K 31/473 - QuinolinesIsoquinolines ortho- or peri-condensed with carbocyclic ring systems, e.g. acridines, phenanthridines
A61K 31/495 - Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with two nitrogen atoms as the only ring hetero atoms, e.g. piperazine
A61K 31/496 - Non-condensed piperazines containing further heterocyclic rings, e.g. rifampin, thiothixene or sparfloxacin
A61K 31/506 - PyrimidinesHydrogenated pyrimidines, e.g. trimethoprim not condensed and containing further heterocyclic rings
The present invention relates to compounds of Formula (I) to their pharmaceutical composition and their use as a medicament, in particular for the treatment and/or prevention of a tumour, viral infection, bacterial infection or neurodegenerative disease.
The present invention relates to compounds of Formula (I) to their pharmaceutical composition and their use as a medicament, in particular for the treatment and/or prevention of a tumour, viral infection, bacterial infection or neurodegenerative disease.
C07D 403/12 - Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, not provided for by group containing two hetero rings linked by a chain containing hetero atoms as chain links
A61K 45/06 - Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
C07D 251/46 - One nitrogen atom with oxygen or sulfur atoms attached to the two other ring carbon atoms
C07D 401/06 - Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, at least one ring being a six-membered ring with only one nitrogen atom containing two hetero rings linked by a carbon chain containing only aliphatic carbon atoms
C07D 401/14 - Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, at least one ring being a six-membered ring with only one nitrogen atom containing three or more hetero rings
C07D 403/06 - Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, not provided for by group containing two hetero rings linked by a carbon chain containing only aliphatic carbon atoms
C07D 403/14 - Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, not provided for by group containing three or more hetero rings
C07D 405/12 - Heterocyclic compounds containing both one or more hetero rings having oxygen atoms as the only ring hetero atoms, and one or more rings having nitrogen as the only ring hetero atom containing two hetero rings linked by a chain containing hetero atoms as chain links
Disclosed is a method for evaluating residual platelet thrombotic potential in patients undergoing antiplatelet treatment, which comprises determination in a patient's blood sample of vasodilator-stimulated phosphoprotein phosphorylation (VASP-P) status and platelet tissue factor (TF) expression.
UNIVERSITY OF FLORIDA RESEARCH FOUNDATION, INC. (USA)
UNIVERSITÁ DEGLI STUDI DI MILANO (Italy)
Inventor
Papke, Roger Lee
Dallanoce, Clelia Mariangiola Luisa
Papotto, Claudio
Abstract
Described herein are sulfonium compounds that are agonists (e.g., silent or partial) of the mammalian α7 or α9 nicotinic acetylcholine receptors. Further provided are pharmaceutical compositions that allow the administration of the sulfonium compounds to a subject in need of treatment for a pathological condition arising from such as inflammation.
A61K 31/382 - Heterocyclic compounds having sulfur as a ring hetero atom having six-membered rings, e.g. thioxanthenes
A61K 31/554 - Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having seven-membered rings, e.g. azelastine, pentylenetetrazole having at least one nitrogen and at least one sulfur as ring hetero atoms, e.g. clothiapine, diltiazem
C07D 279/12 - 1,4-ThiazinesHydrogenated 1,4-thiazines not condensed with other rings
C07D 417/06 - Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and sulfur atoms as the only ring hetero atoms, not provided for by group containing two hetero rings linked by a carbon chain containing only aliphatic carbon atoms
Subject of the invention is a use of a palladium-iron catalyst obtained by galvanic replacement and comprising a support, which comprises layered graphene sheets, carbon nanofibers or graphite, for hydrogenation. A method for hydrogenating an oxygen-containing compound, such as an aliphatic aldehyde, is also claimed.
B01J 23/89 - Catalysts comprising metals or metal oxides or hydroxides, not provided for in group of the iron group metals or copper combined with noble metals
B01J 37/34 - Irradiation by, or application of, electric, magnetic or wave energy, e.g. ultrasonic waves
C07C 29/141 - Preparation of compounds having hydroxy or O-metal groups bound to a carbon atom not belonging to a six-membered aromatic ring by reduction of an oxygen-containing functional group of C=O containing groups, e.g. —COOH of a —CHO group with hydrogen or hydrogen-containing gases
C07C 29/149 - Preparation of compounds having hydroxy or O-metal groups bound to a carbon atom not belonging to a six-membered aromatic ring by reduction of an oxygen-containing functional group of C=O containing groups, e.g. —COOH of carboxylic acids or derivatives thereof with hydrogen or hydrogen-containing gases
C10G 3/00 - Production of liquid hydrocarbon mixtures from oxygen-containing organic materials, e.g. fatty oils, fatty acids
The invention relates to a method for manufacturing anatomical models adapted to simulate organs or parts of organs of a patient. The method includes selecting elements of an anatomical structure of an organ or part of an organ from processed images to obtain a three-dimensional computerized model representing the three-dimensional computerized model by a file having a valid format usable in a three-dimensional printing process; selecting at least one material from a first software library of usable material and at least one manufacturing method from a second software library of manufacturing methods based on a parameter representative of a hardness measurement of said organ; modifying the file representative of the three-dimensional computerized model based on the at least one material and the at least one manufacturing method; using the modified file to perform the process for manufacturing the anatomical model by a three-dimensional printing unit.
The disclosure is directed to pharmaceutical compositions for oral administration comprising deferiprone. In particular, the disclosure is also directed to modified release tablets suitable either for twice daily administration or once daily administration. The disclosure is also directed to methods of making and using the same.
Vascular simulation device (100) for medical training of ultrasound-guided procedures, in particular for realistically simulating ultrasound-guided medical manoeuvres of puncturing blood vessels in an inguinal-femoral region and/or a subclavian/axillary region. The device (100) comprises at least a first vascular structure (40) adapted to let a fluid flow and to simulate an artery, in particular a femoral artery or a subclavian-axillary artery, a second vascular structure (20) adapted to let a fluid flow and to simulate a vein, in particular a femoral vein or a subclavian-axillary vein, and a structure (10), made with a mixture of ballistic gel and graphite or agarose and graphite or silicone and graphite and having echogenic properties, adapted to house at least partially the first vascular structure (40) and the second vascular structure (20). Advantageously, the first vascular structure (40) and/or the second vascular structure (20) are adapted to be fluidically connected to an extracorporeal circulation circuit with circulating liquid (typically a heart-lung machine).
The present invention relates to a vaccine composition comprising a host cell belonging to the genus Leishmania, wherein the host cell comprises a polynucleotide coding for at least one protein of a virus belonging to the family Coronaviridae. Furthermore, the invention relates to the medical and veterinary use of the vaccine composition and to a process for preparing the vaccine composition.
The invention is directed to pharmaceutical compositions for oral administration comprising deferiprone. In particular the invention is directed to a modified-release formulation in form of mini-tablets suitable for twice-a-day oral administration for the treatment of diseases which cause an overload of iron for example, thalassemia, sickle cell anemia, hemochromatosis, and myelodysplasia, or for the prevention and/or treatment of diseases which are caused by an overload of iron. The invention is also directed to methods of making said formulation.
FONDAZIONE IRCCS CA' GRANDA OSPEDALE MAGGIORE POLICLINICO (Italy)
GPI S.P.A. (Italy)
Inventor
Baj, Alessandro
Michelon, Fabio
Abstract
Guide plate for the anatomical realignment of a plurality of fractured bone portions, comprising a back surface configured such as it can be distinctively coupled to the surface anatomy of the area of said plurality of fractured bone portions and characterized by a first plurality of holes placed on a first portion of the guide plate and a second plurality of holes placed on a second portion of the guide plate, wherein the first plurality of holes is misaligned with respect to the second plurality of holes.
22121 containing at least an oxygenated functional group selected from the group consisting of hydroxyl, epoxide, ether, acid, ester, carbonate; ii) polyethylene glycol (PEG) with a molecular weight in the range from 0.2 to 35 kDa; and iii) polytetrahydrofuran with a molecular weight in the range from 0.25 to 2.9 kDa; and - at least an adduct of an allotrope of sp214132101102102101102101102102101102105191102101102102101416 32318222320ne, alkyl-amine, aryl-amine, benzyl-amine and amino-aryl; and 2125110210Hermetia illucensHermetia illucens, and wherein said allotrope of sp2carbon has a surface area higher than 60 m2/g, measured by BET in accordance with the standard ASTM D3037.
C08G 61/02 - Macromolecular compounds containing only carbon atoms in the main chain of the macromolecule, e.g. polyxylylenes
C08L 65/00 - Compositions of macromolecular compounds obtained by reactions forming a carbon-to-carbon link in the main chainCompositions of derivatives of such polymers
C09D 165/00 - Coating compositions based on macromolecular compounds obtained by reactions forming a carbon-to-carbon link in the main chainCoating compositions based on derivatives of such polymers
FONDAZIONE IRCCS “CA’ GRANDA - OSPEDALE MAGGIORE POLICLINICO” (Italy)
Inventor
Tartaglia, Gianluca
Gerges, Irini
Caprioglio, Alberto
Gianni', Aldo Bruno
Goldoni, Riccardo
Mapelli, Andrea
Abstract
The present invention relates to a clear orthodontic aligner comprising at least one molecule capable of changing color or color intensity (CCM). Furthermore, the invention relates to a process for obtaining a clear orthodontic aligner by means of three-dimensional (3D) printing.
Disclosed are an antibody able to recognise and specifically bind the CLIC1 protein located on the cell membrane and inhibit its ion channel function; the uses of said antibody in the diagnostic and therapeutic fields; and pharmaceutical compositions containing the antibody.
C07K 16/28 - Immunoglobulins, e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
A test bench assembly (10) for the simulation of cardiac surgery and/or interventional cardiology operations and/or procedures, comprising a passive heart (12), wherein said passive heart (12) is an explanted or artificial or hybrid heart, said passive heart (12) having at least one pair of cardiac chambers (14, 16; 114, 116) comprising an atrial chamber (14; 114) and a ventricular chamber (16; 116); a reservoir (20), adapted to house the working fluid; a pressure generator (22), adapted to provide said passive heart (12) pumping said working fluid with the pumping function, said pressure generator (22) being fluidically connected both to said ventricular chamber (16) of said passive heart (12) and to said reservoir (20) by means of first fluid connection means; a pressure regulation device (24) which provides the working fluid in input to the atrial chamber (14) with the preload pressure, and the working fluid in output from the ventricular chamber (16) with the afterload pressure, said pressure regulation device (24) being fluidically connected both to said atrial chamber (14) of said passive heart (12) and to said ventricular chamber (16) of said passive heart (12) by means of second fluid connection means; wherein said pressure regulation device (24) comprises a single compliant element (26) for each pair of cardiac chambers (14, 16) which provides the working fluid with both the preload and the afterload pressures.
The present invention relates to a method for diagnosing neurodegenerative diseases, wherein said method comprises measuring the JNK3 levels in a biological sample selected from plasma, CSF, and saliva. In an embodiment, said method also comprises measuring P-JNK3.
COMMISSARIAT A L'ÉNERGIE ATOMIQUE ET AUX ÉNERGIES ALTERNATIVES (France)
CENTRE NATIONAL DE LA RECHERCHE SCIENTIFIQUE (France)
Inventor
Bernardi, Anna
Pollastri, Sara
Delaunay, Clara
Thépaut, Michel
Fieschi, Franck
Abstract
The present invention relates to new glycomimetic molecules which selectively bind to the L-SIGN receptor, finding application in the medical field and, in particular, in the prevention and treatment of viral infections, in the immunotherapy of liver tumors and in the treatment of immune diseases.
A61K 31/7056 - Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing five-membered rings with nitrogen as a ring hetero atom
The invention is directed to pharmaceutical compositions for oral administration in form of coated tablets that exhibit delayed release properties when administered as either whole or half tablets. In particular, the invention is directed to delayed release tablets comprising deferiprone, said tablets being suitable for twice daily oral administration. The invention is also directed to methods of making and using the same.
The invention is directed to pharmaceutical compositions for oral administration comprising deferiprone. In particular, the invention is also directed to delayed release tablets suitable either for twice daily administration or once daily administration. The invention is also directed to methods of making and using the same.
The invention relates to an electronic computing device for generating Boolean functions. The device comprises a conductive module comprising one or more first electrodes, to allow the application of electrical input signals to the conductive module, and one or more second electrodes, to make available electrical output signals from the conductive module. The device comprises one or more input terminals, each of which is selectively connectible to one of said one or more first electrodes for applying electrical input signals to said first electrodes during a step of processing of the device, and one or more output terminals, each of which is selectively connectible to one of said second electrodes to make electrical output signals available on said second electrodes during the step of processing.
The disclosure is directed to pharmaceutical compositions for oral administration comprising deferiprone. In particular, the disclosure is also directed to modified release tablets suitable either for twice daily administration or once daily administration. The disclosure is also directed to methods of making and using the same.
The disclosure is directed to pharmaceutical compositions for oral administration in form of coated tablets that exhibit modified release properties when administered as either whole or half tablets. In particular, the disclosure is directed to modified release tablets comprising deferiprone, said tablets being suitable for twice daily oral administration. The disclosure is also directed to methods of making and using the same.
The present invention relates to LSD1 inhibitors for use in the treatment and/or prevention of a viral infection caused by and/or associated with RNA viruses, preferably Coronaviridae. The LSD1 inhibitors are able to inhibit or prevent the viral induced increased expression of inflammatory cytokines while sparing the expression of Interferon and Interferon-Stimulated Genes. The present invention further concerns a combination and a pharmaceutical composition including the molecules or combinations thereof.
UNIVERSITA' DEGLI STUDI DI ROMA "LA SAPIENZA" (Italy)
ALMA MATER STUDIORUM - UNIVERSITA' DI BOLOGNA (Italy)
UNIVERSITA' DEGLI STUDI DI MILANO (Italy)
POLITECNICO DI MILANO (Italy)
Inventor
Esposito, Francesca
Brucato, John Robert
Cozzolino, Fabio
Mongelluzzo, Giuseppe
Popa, Ciprian Lonut
Fornaro, Teresa
Meneghin, Andrea
Paglialunga, Daniele
Pareschi, Giovanni
De Cesare, Giampiero
Caputo, Domenico
Nascetti, Augusto
Costantini, Francesca
Lovecchio, Nicola
Iannascoli, Lorenzo
Mirasoli, Mara
Michelini, Elisa
Guardigli, Massimo
Clerici, Mario
Trabattoni, Daria
Biasin, Mara
Scaccabarozzi, Diego
Abstract
An apparatus for sampling and detecting a pathogen in air comprising a first air sampling module, a second module for the isolation of viral RNA and a third module for amplification and detection of the viral RNA; thanks to the integration between the modules the apparatus is compact and portable and can be used for in situ sampling of air in closed environments such as ambulances or hospital rooms, air in the external environment and air exhaled by patients.
C12Q 1/70 - Measuring or testing processes involving enzymes, nucleic acids or microorganismsCompositions thereforProcesses of preparing such compositions involving virus or bacteriophage
G01N 1/22 - Devices for withdrawing samples in the gaseous state
The present invention describes compounds of formula (A) for use as Parkinson's disease modifying-agents, said formula (A). Surprisingly it has been found that the compounds of the invention can significantly reduce alpha-synuclein aggregation and stimulate the functional interaction between alpha-synuclein and Synapsin III.
The present invention describes compounds of formula (A) for use as Parkinson's disease modifying-agents, said formula (A). Surprisingly it has been found that the compounds of the invention can significantly reduce alpha-synuclein aggregation and stimulate the functional interaction between alpha-synuclein and Synapsin III.
The invention relates to a method (200) for optically computing a Boolean function with M inputs and a related electro-optical computing system (100). The system comprises : a coherent or partially coherent light radiation source (1) to make M input light beams (L, L1) available; an optical modulation device (3) to generate modulated light beams (L2) from the M input light beams; one or more light-diffusing devices (5) operatively associated with the optical modulation device to receive the modulated light beams; at least one electronic processing unit (9, 10) configured to control the optical modulation device (3); one or more electro-optical sensors operatively associated with said at least one electronic processing unit (9, 10). The method comprises the steps of : generating (201a), by the optical modulation device, the modulated light beams consisting of 2M combinations of the M input light beams, in each of the 2Mcombinations, each input light beam can take an ON state (ON) or an OFF state (OFF); making (201b) the modulated light beams available to the one or more light-diffusing devices to generate 2Mrandom or pseudo-random fields (20) each associated with a combination of the modulated light beams; each random field is representative of a set of random light intensity variations of points in an observation space (S), each pseudo-random field is representative of a set of deterministic light intensity variations of points in the observation space; deriving (201c) 2MBoolean fields (30) each associated with one of the 2Mgenerated random or pseudo-random fields, based on a comparison of the light intensity of the points of one or more regions of the observation space associated with each of the 2Mrandom or pseudo random fields with at least one threshold light intensity value (TH), each Boolean field includes: first points of one or more regions of the observation space in which the light intensity of the related random or pseudo-random field is greater than the at least one threshold light intensity value, such first points being representative of a logical 1; second points of the one or more regions of the observation space in which the light intensity of the related random or pseudo-random field is lower than said at least one threshold light intensity value, such second points being representative of a logical 0; selecting (201d) a target Boolean function (F) with M inputs; identifying (201e), by the at least one electronic processing unit (9, 10), active points (31) between the first and second points of each of the 2M derived Boolean fields (30) which satisfy the selected target Boolean function; computing (202) the Boolean function with M inputs based on said identified active points.
RESEARCH INSTITUTE AT NATIONWIDE CHILDREN'S HOSPITAL (USA)
FONDAZIONE IRCCS CA' GRANDA OSPEDALE MAGGIORE POLICLINICO (Italy)
UNIVERSITÀ DEGLI STUDI DI MILANO (Italy)
Inventor
Meyer, Kathrin Christine
Likhite, Shibi
Foust, Kevin
Kaspar, Brian K.
Nizzardo, Monica
Corti, Stefania Paola
Abstract
The disclosure provides gene therapy vectors, such as adeno-associated virus (AAV), designed for treatment of an immunoglobulin- µ binding protein 2 (IGHMB P2)-related disorder.
UNIVERSITA' DEGLI STUDI DI ROMA "TOR VERGATA" (Italy)
UNIVERSITA' POLITECNICA DELLE MARCHE (Italy)
Inventor
Borsello, Tiziana
Falconi, Mattia
Di Marino, Daniele
Abstract
The subject of the present invention is a peptide, natural or synthetic, which comprises an amino acid sequence that has at least 80% sequence identity with the sequence SDRSLHLEANEKGENVNVHVTKTRADKSKIKVSVRQYADINEKGEAQYKCP-VAQLE (SEQ ID NO: 1). A further object of the present invention is said peptide which has at least 80% sequence identity with the sequence SEQ ID NO: 1 which is a JNK3 inhibitor for use in the prevention and / or treatment of neurodegenerative or neurodevel-opmental diseases.
C07K 14/47 - Peptides having more than 20 amino acidsGastrinsSomatostatinsMelanotropinsDerivatives thereof from animalsPeptides having more than 20 amino acidsGastrinsSomatostatinsMelanotropinsDerivatives thereof from humans from vertebrates from mammals
A61K 47/64 - Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent
A61P 25/28 - Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
The present invention relates to a method for predicting the inflammatory response of mononuclear cells exposed to a prosthetic implant. In an embodiment, said method is for use in the patient-specific selection of prosthetic implants. The present invention further relates to a multi-well plate for cell cultures adapted to test prosthetic implants, characterized in that the wells contained in said plate are grouped into at least two subsets, where the feature defining the belonging of a well to one of said subsets is the base surface roughness of said wells.
The present invention relates to methods and kits for the evaluation of risk and treatment of distant recurrence of breast cancer in a subject. The methods and kits can comprise combining the measured expression levels of a subset of genes selected from a 20-gene signature with tumor size and nodal status to determine the risk of distant recurrence.
C12Q 1/6886 - Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes for diseases caused by alterations of genetic material for cancer
G16H 50/30 - ICT specially adapted for medical diagnosis, medical simulation or medical data miningICT specially adapted for detecting, monitoring or modelling epidemics or pandemics for calculating health indicesICT specially adapted for medical diagnosis, medical simulation or medical data miningICT specially adapted for detecting, monitoring or modelling epidemics or pandemics for individual health risk assessment
58.
Writing instrument, system and method for transparent monitoring and analysis of writing
A writing instrument that includes a writing element for depositing a writing material on a support and a plurality of sensors including at least a force sensor and a movement sensor, a communication unit that exchanges data with a remote device a control unit connected to the sensors and to the communication unit in order to transmit to the remote device the measurements provided by the sensors, a memory unit connected to the control unit that stores one or more measurements from the sensors; and a hollow casing that contains at least part of the writing element so that the writing end is exposed, and also houses the sensors, the control unit, the memory unit and the communication unit.
G06F 3/0354 - Pointing devices displaced or positioned by the userAccessories therefor with detection of 2D relative movements between the device, or an operating part thereof, and a plane or surface, e.g. 2D mice, trackballs, pens or pucks
B43K 29/08 - Combinations of writing implements with other articles with measuring, computing or indicating devices
Disclosed is a process for the preparation of taxanes esterified with octadecanedioic acid which comprises reacting a taxane with an octadecanedioic acid protected in one of the two carboxyl groups and protected with a group removable by catalysis with transition metals.
C07D 305/14 - Heterocyclic compounds containing four-membered rings having one oxygen atom as the only ring hetero atoms condensed with carbocyclic rings or ring systems
C07C 67/03 - Preparation of carboxylic acid esters by reacting an ester group with a hydroxy group
C07C 69/34 - Esters of acyclic saturated polycarboxylic acids having an esterified carboxyl group bound to an acyclic carbon atom
60.
ELECTROCHEMICAL IODINATION OF N,N'-(2,3-DIHYDROXYPROPYL)-5-HYDROXY-1,3-BENZENEDICARBOXAMIDE
The invention is related to a process for preparing a iodinating X-rays contrast agent. More specifically, it relates to a process for the preparation of N,N'-bis-(2,3-dihydroxypropyl)-5-hydroxy-2,4,6-triiodo-1,3-benzenedicarboxamide (I) by electrochemical iodination of N,N'-(2,3-dihydroxypropyl)-5-hydroxy-1,3-benzenedicarboxamide (II) with molecular iodine (I2) which is in situ electrochemically generated from a source of iodide ions (I-). The iodide ions (I-) are obtained by the dissolution of hydrogen iodide (HI) or an alkali metal iodide in the reaction medium or produced during the reaction of N,N'-(2,3-dihydroxypropyl)-5-hydroxy-1,3-benzenedicarboxamide with I2. The invention also relates to the use of the intermediate compound of formula (I), obtained through the above electrochemical iodination of compound (II), in the preparation of N,N'-bis[2,3-dihydroxypropyl]-5(hydroxyacetyl)methylamino]-2,4,6-triiodo-1,3-benzenedicarboxamide (iomeprol).
C07C 231/12 - Preparation of carboxylic acid amides by reactions not involving the formation of carboxamide groups
C07C 235/46 - Carboxylic acid amides, the carbon skeleton of the acid part being further substituted by oxygen atoms having carbon atoms of carboxamide groups bound to carbon atoms of six-membered aromatic rings and singly-bound oxygen atoms bound to the same carbon skeleton with carbon atoms of carboxamide groups and singly-bound oxygen atoms bound to carbon atoms of the same non-condensed six-membered aromatic ring having the nitrogen atoms of the carboxamide groups bound to hydrogen atoms or to acyclic carbon atoms
C07C 235/48 - Carboxylic acid amides, the carbon skeleton of the acid part being further substituted by oxygen atoms having carbon atoms of carboxamide groups bound to carbon atoms of six-membered aromatic rings and singly-bound oxygen atoms bound to the same carbon skeleton with carbon atoms of carboxamide groups and singly-bound oxygen atoms bound to carbon atoms of the same non-condensed six-membered aromatic ring having the nitrogen atom of at least one of the carboxamide groups bound to an acyclic carbon atom of a hydrocarbon radical substituted by singly-bound oxygen atoms
C07C 237/46 - Carboxylic acid amides, the carbon skeleton of the acid part being further substituted by amino groups having the carbon atom of at least one of the carboxamide groups bound to a carbon atom of a non-condensed six-membered aromatic ring of the carbon skeleton having carbon atoms of carboxamide groups, amino groups and at least three atoms of bromine or iodine, bound to carbon atoms of the same non-condensed six-membered aromatic ring
The present invention relates to a polypeptide which is a temperature-modulated ion channel, wherein said ion channel is a channel comprising four subunits which associate to form a homo- or hetero-tetramer, preferably is a potassium channel, wherein said polypeptide comprises at least one peptide comprising at least one portion of one of said subunits and a portion of the cytoplasmic C-terminal domain of the bacterial voltage-gated sodium channel BacNaν, wherein said portion comprises at least one mutation in one of the amino acids in position 267, 271 or 274, wherein said numbering is read with reference to the voltage-gated sodium channel BacNav, SEQ ID NO: 5. The present invention further relates to the use of said polypeptide in the treatment of a condition modulated by potassium channel activity, selected from the group comprising: neuromyotonia, episodic ataxia type 1, hereditary deafness syndromes, benign familial neonatal seizures and periodic hypokalemic paralysis, neuropathic pain, diabetic neuropathic pain, trauma (thoracic surgery), glioblastoma, skin diseases, in particular originating from keratinocyte dysfunctions.
Disclosed is a method for evaluating residual platelet thrombotic potential in patients undergoing antiplatelet treatment, which comprises determination in a patient's blood sample of vasodilator-stimulated phosphoprotein phosphorylation (VASP-P) status and platelet tissue factor (TF) expression.
The present invention relates to a method for calculating one or more isovists of a physical or extended reality environment, comprising the following steps: providing at least one electronic acquisition device configured to obtain a plurality of georeferenced data, such as time, position, orientation, and configured to take frames of the physical or extended reality environment; calculating a positioning parameter for each user, each positioning parameter being representative of a positioning point of a respective user in the physical or extended reality environment and being determined from the georeferenced position data acquired when said respective user uses the electronic acquisition device to take a frame of the physical or extended reality environment; calculating an aim parameter for each user, each aim parameter being representative of the direction of a respective frame of the physical or extended reality environment taken by a user at the respective positioning point and being calculated from the georeferenced orientation data acquired when such respective user uses the electronic acquisition device to take the frame; associating each positioning parameter with a respective aim parameter to define respective data units; grouping into respective positioning sets data units having respective positioning parameters differing from each other by a value lower than a positioning threshold value and respective aim parameters differing from each other by a value lower than an aim threshold value; calculating at least one isovist for each positioning set as a function of the respective positioning and/or aim parameters; representing each calculated isovist in a graphical user interface of an electronic display device.
The invention relates to a method (100) for manufacturing anatomical models (1) adapted to simulate organs or parts of organs (2) of a patient. The method comprises the steps of: - obtaining (101) information on the anatomical structure of an organ or part of an organ by processing digital images of said organ; - selecting (102), by means of digital image processing software, elements of the anatomical structure of the organ or part of the organ from the processed images to obtain (103) a three-dimensional computerized model of the anatomical structure of said organ; - representing (104) the three-dimensional computerized model by means of a file (STL) having a valid format usable in a three-dimensional printing process; - manufacturing (105) the representative anatomical model of the organ to be simulated by means of the three-dimensional printing process. Said step of manufacturing comprises the further steps of: - providing (106') a first software library including digital data representative of a plurality of materials usable for manufacturing the anatomical model of the organ to be simulated; - providing (106'') a second software library including digital data representative of a plurality of methods for manufacturing the anatomical model of the organ to be simulated; said manufacturing methods are usable either alternatively or mutually in combination in the three-dimensional printing process; - selecting (107) at least one material from the first software library and at least one manufacturing method from the second software library based on a parameter representative of a hardness measurement of said organ to be simulated; - modifying (108) the file representative of the three-dimensional computerized model based on the at least one material and the at least one manufacturing method selected to generate a further file (STL1) representative of the modified three-dimensional computerized model; - using (109) the further modified file (STL1) to perform the process for manufacturing the anatomical model by means of a three-dimensional printing unit (204).
UNIVERSITA' DEGLI STUDI DI NAPOLI FEDERICO II (Italy)
Inventor
Marinelli, Luciana
Arosio, Daniela
Seneci, Pierfausto
Abstract
The present invention relates to compounds of Formula (I) to their pharmaceutical composition and their use as a medicament, in particular for the treatment and/ or prevention of a tumour, viral infection, bacterial infection or neurodegenerative disease.
C07D 401/06 - Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, at least one ring being a six-membered ring with only one nitrogen atom containing two hetero rings linked by a carbon chain containing only aliphatic carbon atoms
C07D 401/14 - Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, at least one ring being a six-membered ring with only one nitrogen atom containing three or more hetero rings
C07D 403/12 - Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, not provided for by group containing two hetero rings linked by a chain containing hetero atoms as chain links
A61P 25/00 - Drugs for disorders of the nervous system
A61P 31/00 - Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
A61K 31/53 - Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with three nitrogens as the only ring hetero atoms, e.g. chlorazanil, melamine
66.
METHOD FOR AUTOMATED DESIGN AND FOR MANUFACTURE OF MECHANICAL ACTUATORS BY USING OF TOPOLOGICAL TRUSS-BASED METAMATERIALS
Described a computer-implemented method for the automated design of a mechanical actuator by using metamaterials. The method comprises: defining an initial lattice model of the metamaterial, constituted by the repetition of basic geometric elements formed by a plurality of nodes connected by a plurality of beams; defining several groups of nodes; and iterating a series of steps, including: modifying a current test lattice, on the basis of a pseudo-random decision determined by means of a computational algorithm; simulating, by means of computational simulation, the mechanical response of the modified test lattice; calculating a figure of merit of the modified test lattice on the basis of positions of input and output nodes in presence of an input mechanical stimulus; either accepting or rejecting the modified test lattice; and finally defining the current test lattice for the subsequent iteration is as the initial lattice at the first iteration.
A conditioning device for conditioning an exposed stretch of a blood vessel has an envelope and at least one conveying channel extending entirely within the envelope. The envelope has a first layer having a first surface facing the exposed stretch, and a second layer having a second surface, opposite to the first surface. The at least one conveying channel has at least one first aperture leading out of the envelope, so that the at least one conveying channel is suppliable with working fluid through the at least one first aperture. The first layer is permeable to at least one component of the working fluid, so that, when the working fluid is in the at least one conveying channel, the at least one component, permeating the first layer, diffuses until reaching the first surface to apply a conditioning action on the exposed stretch of the blood vessel.
Leishmania Leishmania, wherein the host cell comprises a polynucleotide coding for at least one protein of a virus belonging to the family Coronaviridae. Furthermore, the invention relates to the medical and veterinary use of the vaccine composition and to a process for preparing the vaccine composition.
OFFICINA DELLE SOLUZIONI SNC DI BONINO MICHELINO, MOLTENI FEDERICO E TORTA FABIO FISCALMENTE SIGLABILE "ODIESSE SNC" (Italy)
Inventor
Guidetti, Riccardo
Beghi, Roberto
Giovenzana, Valentina
Tugnolo, Alessio
Casson, Andrea
Pampuri, Alessia
Torta, Fabio
Molteni, Federico
Bonino, Michelino
Abstract
The present invention describes a portable device (1) for analysing vegetable matrices (VM) in the field comprising a support body (2) with an element (3a, 3b) configured to completely embrace a vegetable matrix (VM), a measurement element (10) configured for a spectral measurement, in a given wavelength range, of the vegetable matrix (VM) so as to acquire optical reflectance (OR) data of the surface of the vegetable matrix (VM), an electrical power source configured to power the various elements of the device, a processing unit associated with the device and configured to receive the optical reflectance (OR) data acquired by the measurement element (10) and generating a signal representative of at least one characteristic chemical-physical parameter (Pi) of the vegetable matrix (VM) or generating a classification of the analysed vegetable matrix (VM) on the basis of classes.
G01N 21/31 - Investigating relative effect of material at wavelengths characteristic of specific elements or molecules, e.g. atomic absorption spectrometry
The present invention relates to a composition for use as a food supplement to reduce hepatic metabolic imbalances resulting from insufficient ovarian estrogen production comprising at least the essential amino acids isoleucine, leucine, valine.
FONDAZIONE IRCCS ISTITUTO NAZIONALE DEI TUMORI (Italy)
Inventor
Ciana, Paolo
Garofalo, Mariangela
Villa, Alessandro Maria
Mazzaferro, Vincenzo
Maggi, Adriana
Abstract
Extracellular vesicles isolated from blood plasma of oncological patients for selectively delivering therapeutic or diagnostic drugs are provided. Methods for isolating extracellular vesicles from an isolated sample of blood plasma and for preparing an isolated sample of blood plasma from oncological patients are also provided.
ab and ΔR detected by beam detectors located downstream of an interferometric structure 40 to which two portions of the electromagnetic beam carrying the modulated channels are provided as inputs, multiplexed in the orbital angular momentum variable. There is also described a corresponding system 100 for demultiplexing and demodulating amplitude-modulated signals capable of implementing the aforesaid method.
H04J 14/02 - Wavelength-division multiplex systems
74.
Method and system for transmitting and receiving an electromagnetic radiation beam with detection of orbital angular momentum and related telecommunication method and system
A method for transmitting and receiving an electromagnetic radiation beam, adapted to determine an orbital angular momentum of the received electromagnetic radiation beam, is described. There is further described a system for transmitting and receiving an electromagnetic radiation beam, capable of performing the aforesaid method. A method for performing a telecommunication of signals modulated according to any modulation technique and grouped by means of orbital angular momentum multiplexing is further described. There is further described a telecommunication system capable of performing the aforesaid method for performing a telecommunication of modulated signals.
A method for culturing cells on a substrate capable of inducing pluripotency is provided. The method includes plating cells on a nichoid-type substrate, allowing cultured cells to proliferate for a certain period of time, detaching cells from the nichoid-type substrate, and, once cells have been detached, culturing cells in suspension or under adhesion.
Disclosed are an antibody able to recognise and specifically bind the CLIC1 protein located on the cell membrane and inhibit its ion channel function; the uses of said antibody in the diagnostic and therapeutic fields; and pharmaceutical compositions containing the antibody.
C07K 16/28 - Immunoglobulins, e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
A61P 25/28 - Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
A61P 29/00 - Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agentsNon-steroidal antiinflammatory drugs [NSAID]
Disclosed is an electronic computing device (100) for generating Boolean functions. The device comprises a conductive module (10) comprising one or more first electrodes (i1, i2,..., iN), to allow the application of electrical input signals to the conductive module, and one or more second electrodes (ol, o2,..., oM), to make available electrical output signals from the conductive module. The device comprises one or more first voltage (Vlw,..., VNw) or current (llw,..., INw) generators, each selectively connectible to one of said one or more first electrodes during a step of encoding of the device, and one or more second voltage (Vlo,..., VMo) or current (No,..., IMo) generators, each selectively connectible to one of said one or more second electrodes during the step of encoding. The device comprises one or more input terminals (rl,..., rN), each of which is selectively connectible to one of said one or more first electrodes (i1 i2,..., iN) for applying electrical input signals (xl,.. xN) to said first electrodes during a step of processing of the device, and one or more output terminals (tl,..., tM), each of which is selectively connectible to one of said second electrodes to make electrical output signals (yl,..., yM) available on said second electrodes during the step of processing. The device comprises a functional block (20) connected to said one or more output terminals to receive in input the electrical output signals from the conductive module and to generate an output signal (OT) obtained by processing such electrical output signals.
H01L 27/24 - Devices consisting of a plurality of semiconductor or other solid-state components formed in or on a common substrate including solid state components for rectifying, amplifying, or switching without a potential-jump barrier or surface barrier
G06N 3/063 - Physical realisation, i.e. hardware implementation of neural networks, neurons or parts of neurons using electronic means
H03K 19/02 - Logic circuits, i.e. having at least two inputs acting on one outputInverting circuits using specified components
H01L 45/00 - Solid state devices specially adapted for rectifying, amplifying, oscillating, or switching without a potential-jump barrier or surface barrier, e.g. dielectric triodes; Ovshinsky-effect devices; Processes or apparatus specially adapted for the manufacture or treatment thereof or of parts thereof
78.
Test bench assembly for the simulation of cardiac surgery and/or interventional cardiology operations and/or procedures
A test bench assembly for simulating cardiac surgery includes a passive heart having at least one pair of cardiac chambers with an atrial chamber and a ventricular chamber. A reservoir is adapted to house working fluid. A pressure generator fluidically connects both to the ventricular chamber of the passive heart and to the reservoir. A pressure regulation device provides working fluid in input to the atrial chamber with preload pressure, and working fluid in output from the ventricular chamber with afterload pressure. The pressure regulation device fluidically connects both to the atrial chamber of the passive heart and to the ventricular chamber of the passive heart. The pressure regulation device has a single compliant element for each pair of cardiac chambers, which provides working fluid with both preload, and afterload pressures.
UNIVERSITA' DEGLI STUDI DI MODENA E REGGIO EMILIA (Italy)
UNIVERSITA' DEGLI STUDI DI MILANO (Italy)
ISTITUTO NAZIONALE DI GENETICA MOLECOLARE - INGM (Italy)
Inventor
Birolini, Giulia
Cattaneo, Elena
Forni, Flavio
Linciano, Pasquale
Ruozi, Barbara
Tosi, Giovanni
Valenza, Marta
Vandelli, Maria Angela
Abstract
The present invention relates to nanoparticles for the delivery of active ingredients across the blood-brain barrier, wherein said nanoparticles comprise at least one ligand bound on the surface of a colloidal system, wherein said at least one ligand is at least one linear or branched fatty acid, optionally substituted and/or esterified, saturated or unsaturated, with a number of carbon atoms between 4 and 22 and said colloidal system comprises or consists of at least one constituent and, optionally, one or more active ingredients, characterized in that said ligand is bound by a chemical bond to at least one functional group which is present on one or more of the constituents of said colloidal system, so as to form a constituent-ligand conjugate.
B01J 13/00 - Colloid chemistry, e.g. the production of colloidal materials or their solutions, not otherwise provided forMaking microcapsules or microballoons
A61K 9/48 - Preparations in capsules, e.g. of gelatin, of chocolate
A61K 49/18 - Nuclear magnetic resonance [NMR] contrast preparationsMagnetic resonance imaging [MRI] contrast preparations characterised by a special physical form, e.g. emulsions, microcapsules, liposomes
B01J 13/02 - Making microcapsules or microballoons
B01J 13/04 - Making microcapsules or microballoons by physical processes, e.g. drying, spraying
FONDAZIONE IRCCS "CA' GRANDA - OSPEDALE MAGGIORE POLICLINICO" (Italy)
Inventor
Pesenti, Antonio Maria
Zanella, Alberto
Abstract
A system is described for the regional decoagulation of the blood in an extracorporeal circulation circuit comprising means for infusion of a solution of a citrate or citric acid on the main circuit, which are set upstream of the first filtration unit; for infusion of a solution for electrolyte restoration on the main circuit, which are set downstream of the filtration unit and a secondary circuit for recirculation of the plasma water obtained by the filtration unit. The secondary circuit comprises: a first cartridge comprising an anion-exchange resin charged with chlorine ions; a second cartridge comprising a cation-exchange resin charged with sodium and potassium ions, which is set downstream of the first cartridge and means for removal of a first fraction of the plasma water obtained by the filtration unit.
A61M 1/36 - Other treatment of blood in a by-pass of the natural circulatory system, e.g. temperature adaptation, irradiation
A61M 1/16 - Dialysis systemsArtificial kidneysBlood oxygenators with membranes
A61M 1/34 - Filtering material out of the blood by passing it through a membrane, i.e. hemofiltration, diafiltration
B01D 15/36 - Selective adsorption, e.g. chromatography characterised by the separation mechanism involving ionic interaction, e.g. ion-exchange, ion-pair, ion-suppression or ion-exclusion
IFOM - ISTITUTO FIRC DI ONCOLOGIA MOLECOLARE (Italy)
ISTITUTO EUROPEO DI ONCOLOGIA S.R.L (Italy)
UNIVERSITA' DEGLI STUDI DI MILANO (Italy)
Inventor
Testa, Giuseppe
Cavallo, Francesca
Troglio, Flavia
Faga, Giovanni
Fancelli, Daniele
Abstract
The present invention relates to histone deacetylase inhibitors and to pharmaceutical compositions comprising the same for use for the prevention and/or treatment of autism spectrum disorder, in particular 7Dup and other forms of intellectual disability and autism.
A61K 31/167 - Amides, e.g. hydroxamic acids having aromatic rings, e.g. colchicine, atenolol, progabide having the nitrogen atom of a carboxamide group directly attached to the aromatic ring, e.g. lidocaine, paracetamol
A61K 31/506 - PyrimidinesHydrogenated pyrimidines, e.g. trimethoprim not condensed and containing further heterocyclic rings
A61K 45/06 - Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
A61P 25/00 - Drugs for disorders of the nervous system
A61P 43/00 - Drugs for specific purposes, not provided for in groups
G01N 33/00 - Investigating or analysing materials by specific methods not covered by groups
The subject of the present invention is a transgenic cassette comprising a promoter operatively connected to a DNA fragment, characterized in that: - said promoter comprises at least one FOXO binding element, at least one myogenin binding element, at least one SMAD binding element and at least three E-boxes-binding sites (EM) for TWIST1; - said DNA fragment comprises at least one reporter gene. A further object of the present invention is an engineered non-human animal, tissues and / or cells derived therefrom, engineered cells, where said engineering includes the introduction of a transgenic cassette according to the present invention, and their uses to evaluate the impact of compounds on muscle atrophy.
The present invention describes compounds of formula (A) for use as Parkinson's disease modifying-agents, said formula (A). Surprisingly it has been found that the compounds of the invention can significantly reduce alpha-synuclein aggregation and stimulate the functional interaction between alpha-synuclein and Synapsin III.
UNIVERSITA' DEGLI STUDI DI ROMA "LA SAPIENZA" (Italy)
ALMA MATER STUDIORUM - UNIVERSITA' DI BOLOGNA (Italy)
UNIVERSITA' DEGLI STUDI DI MILANO (Italy)
POLITECNICO DI MILANO (Italy)
Inventor
Esposito, Francesca
Brucato, John Robert
Cozzolino, Fabio
Mongelluzzo, Giuseppe
Popa, Ciprian Ionut
Fornaro, Teresa
Meneghin, Andrea
Paglialunga, Daniele
Pareschi, Giovanni
De Cesare, Giampiero
Caputo, Domenico
Nascetti, Augusto
Costantini, Francesca
Lovecchio, Nicola
Iannascoli, Lorenzo
Mirasoli, Mara
Michelini, Elisa
Guardigli, Massimo
Clerici, Mario
Trabattoni, Daria
Biasin, Mara
Scaccabarozzi, Diego
Abstract
An apparatus (1) for sampling and detecting a pathogen in air comprising a first air sampling module (A), a second module (B) for the isolation of viral RNA and a third module (C) for amplification and detection of the viral RNA; thanks to the integration between the modules (A, B, C) the apparatus (1) is compact and portable and can be used for in situ sampling of air in closed environments such as ambulances or hospital rooms, air in the external environment and air exhaled by patients.
The invention relates to compounds of general formula (I): having inhibitory activity against the PCSK9 enzyme. Said compounds can be used, for example, in the prevention and/or treatment of dyslipidaemia.
C07D 233/61 - Heterocyclic compounds containing 1,3-diazole or hydrogenated 1,3-diazole rings, not condensed with other rings having two double bonds between ring members or between ring members and non-ring members with only hydrogen atoms or radicals containing only hydrogen and carbon atoms, attached to ring carbon atoms with hydrocarbon radicals, substituted by nitrogen atoms not forming part of a nitro radical, attached to ring nitrogen atoms
C07D 233/64 - Heterocyclic compounds containing 1,3-diazole or hydrogenated 1,3-diazole rings, not condensed with other rings having two double bonds between ring members or between ring members and non-ring members with substituted hydrocarbon radicals attached to ring carbon atoms, e.g. histidine
UNIVERSITA' DEGLI STUDI DI ROMA "TOR VERGATA" (Italy)
UNIVERSITA' POLITECNICA DELLE MARCHE (Italy)
Inventor
Borsello, Tiziana
Falconi, Mattia
Di Marino, Daniele
Abstract
The subject of the present invention is a peptide, natural or synthetic, which comprises an amino acid sequence that has at least 80% sequence identity with the sequence SDRSLHLEANEKGENVNVHVTKTRADKSKIKVSVRQYADINEKGEAQYKCPVAQLE (SEQ ID NO: 1). A further object of the present invention is said peptide which has at least 80% sequence identity with the sequence SEQ ID NO: 1 which is a JNK3 inhibitor for use in the prevention and / or treatment of neurodegenerative or neurodevelopmental diseases.
C07K 14/47 - Peptides having more than 20 amino acidsGastrinsSomatostatinsMelanotropinsDerivatives thereof from animalsPeptides having more than 20 amino acidsGastrinsSomatostatinsMelanotropinsDerivatives thereof from humans from vertebrates from mammals
C12N 15/62 - DNA sequences coding for fusion proteins
C07K 14/20 - Peptides having more than 20 amino acidsGastrinsSomatostatinsMelanotropinsDerivatives thereof from bacteria from Spirochaetales (O), e.g. Treponema, Leptospira
87.
METHODS AND KITS FOR DETERMINING THE RISK OF BREAST CANCER RECURRENCE
The present invention relates to methods and kits for the evaluation of risk and treatment of distant recurrence of breast cancer in a subject. The methods and kits can comprise combining the measured expression levels of a subset of genes selected from a 20-gene signature with tumor size and nodal status to determine the risk of distant recurrence.
C12Q 1/6886 - Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes for diseases caused by alterations of genetic material for cancer
88.
MOLECULES FOR USE IN THE TREATMENT OF VIRAL INFECTIONS
The present invention relates to LSD1 inhibitors for use in the treatment and/or prevention of a viral infection caused by and/or associated with RNA viruses, preferably Coronaviridae. The LSD1 inhibitors are able to inhibit or prevent the viral induced increased expression of inflammatory cytokines while sparing the expression of Interferon and Interferon-Stimulated Genes. The present invention further concerns a combination and a pharmaceutical composition comprising said molecules or combinations thereof.
A61K 31/167 - Amides, e.g. hydroxamic acids having aromatic rings, e.g. colchicine, atenolol, progabide having the nitrogen atom of a carboxamide group directly attached to the aromatic ring, e.g. lidocaine, paracetamol
A61K 31/4045 - Indole-alkylaminesAmides thereof, e.g. serotonin, melatonin
A61K 31/4406 - Non-condensed pyridinesHydrogenated derivatives thereof only substituted in position 3, e.g. zimeldine
A61K 31/5377 - 1,4-Oxazines, e.g. morpholine not condensed and containing further heterocyclic rings, e.g. timolol
A61K 31/706 - Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom
A61K 45/06 - Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
The present invention relates to a writing instrument (1) comprising: - a writing element (20) comprises a writing end (21) configured for depositing a writing material on a support; - a plurality of sensors comprising at least: - a force sensor (30) configured to measure a force applied to said writing element (20), and - a movement sensor (43) configured to measure movement of the instrument (1) in a three- dimensional space; - a communication unit (44) configured to exchange data with a remote device via a wireless communication channel; - a control unit (41) connected to the plurality of sensors and to the communication unit (44) configured to control said plurality of sensors and said communication unit (44) in order to transmit to the remote device the measures provided of the plurality of sensors in presence of a connection between the communication unit (44) and the remote device, - a memory unit (42) connected to the control unit (41) and configured to store one or more measures of said plurality of sensors, and - a hollow casing (10) configured to contain at least partially said writing element (20), so as to leave the writing end (21) of the writing element (20) exposed through a first end (11) of the casing (10), and to contain completely said plurality of sensors, the control unit (41), the memory unit (42) and the communication unit (44). Advantageously, the control unit is further configured: - to detect a condition of lack of connection between the communication unit (44) and the remote device, - in such a condition of lack of connection, to detect writing measures corresponding to movement measures having amplitude of movement greater than a threshold, and - to store the writing measures if, within a predetermined period of time, the control unit detects a number of writing measures greater than a predetermined number.
G06F 3/0354 - Pointing devices displaced or positioned by the userAccessories therefor with detection of 2D relative movements between the device, or an operating part thereof, and a plane or surface, e.g. 2D mice, trackballs, pens or pucks
A61B 5/00 - Measuring for diagnostic purposes Identification of persons
B43K 29/00 - Combinations of writing implements with other articles
90.
ADAM10 ENDOCYTOSIS INHIBITOR PEPTIDES AND RELATED USES FOR THE TREATMENT OF ALZHEIMER'S DISEASE
The present invention relates to new cellular peptides permeable to cell membranes capable of interfering with the CAP2/actin association and inhibiting the endocytosis of the ADAM10 enzyme. Also contemplated are pharmaceutical compositions comprising the endocytosis inhibitory peptides of ADAM10 and the related uses in the medical field for the treatment and/or prevention of pathologies in which an increase or accumulation of the β-amyloid peptide occurs, such as for example Alzheimer's disease, head injury and post-traumatic stress disorder.
A61K 38/17 - Peptides having more than 20 amino acidsGastrinsSomatostatinsMelanotropinsDerivatives thereof from animalsPeptides having more than 20 amino acidsGastrinsSomatostatinsMelanotropinsDerivatives thereof from humans
A61P 25/28 - Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
C07K 14/00 - Peptides having more than 20 amino acidsGastrinsSomatostatinsMelanotropinsDerivatives thereof
91.
Oligosaccharides for use in the treatment of Parkinson's disease
Oligosaccharides are for use in the treatment of neurodegenerative diseases of the central nervous system, in particular Parkinson's disease, and to pharmaceutical compositions including one or more of the oligosaccharides.
A61P 25/28 - Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
The present invention relates to a microelectrode, in particular a microelectrode for Scanning Electrochemical Microscopy and electroanalysis or for microchemical reactors and for so-called electrochemical micromachining (EMM), and to a manufacturing method thereof. In particular, the invention relates to a microelectrode (1, 101, 201, 301) comprising at least one electrode element (10, 10') comprising an electrode wire (2) and a contact wire (3), and an electrode body (4, 104, 204, 304) made of a polymer material, wherein the electrode wire (2) and the contact wire (3) are joined by a junction (5) made of an at least partially conductive material and are embedded in said electrode body (4, 104, 204, 304), and wherein the electrode wire (2) ends at the level of a distal end (4a, 104a, 204a, 304a) of the electrode body (4, 104, 204, 304), so that only a discoid surface (2a) of the electrode wire (2) remains exposed, and wherein the contact wire (3) ends outside the proximal end (4b, 104b, 204b, 304b) of the electrode body (4, 104, 204, 304).
RESEARCH INSTITUTE AT NATIONWIDE CHILDREN'S HOSPITAL (USA)
FONDAZIONE IRCCS CA' GRANDA OSPEDALE MAGGIORE POLICLINICO (Italy)
UNIVERSTA DEGLI STUDI DI MILANO (Italy)
Inventor
Meyer, Kathrin, Christine
Likhite, Shibi
Foust, Kevin
Kaspar, Brian, K.
Nizzardo, Monica
Corti, Stefania, Paola
Abstract
The disclosure provides gene therapy vectors, such as adeno-associated virus (AAV), designed for treatment of an immunoglobulin- μ binding protein 2 (IGHMB P2)-related disorder.
C07K 14/435 - Peptides having more than 20 amino acidsGastrinsSomatostatinsMelanotropinsDerivatives thereof from animalsPeptides having more than 20 amino acidsGastrinsSomatostatinsMelanotropinsDerivatives thereof from humans
C12N 15/87 - Introduction of foreign genetic material using processes not otherwise provided for, e.g. co-transformation
94.
METHOD FOR AUTOMATED DESIGN AND FOR MANUFACTURE OF MECHANICAL ACTUATORS BY USING TOPOLOGICAL TRUSS-BASED METAMATERIALS
A computer-implemented method for the automated design of a mechanical actuator 1 by using metamaterials is described. Such a method firstly comprises the step of defining an initial lattice model 2 of the metamaterial, constituted by the repetition of basic geometric elements 3, either two- dimensional or three-dimensional, formed by a plurality of nodes 4 connected by a plurality of beams 5. Then, the method provides defining, between the nodes of the aforesaid regular lattice, the following groups of nodes: a first group of input nodes 41, which constitute an input region R1 intended to receive at least one input mechanical stimulus Mi; a second group of output nodes 42, which constitute an output region R2 intended to provide a desired output mechanical movement, as a result of the action of the actuator; and a third group of removable nodes 43, distinct from the aforesaid nodes of the first group and of the second group. The method then comprises iterating a series of steps which will be described below. In the iteration, the step of modifying a current test lattice is performed, on the basis of a pseudo-random decision determined by means of a computational algorithm, by removing or adding a removable node, or by removing or adding a beam afferent to a removable node, to obtain a modified test lattice. The step is then provided of simulating, by means of computational simulation, the mechanical response of the modified test lattice, when an input mechanical stimulus is applied to the input nodes of the first group, to determine the consequent output mechanical movement of the output nodes of the second group, and to establish the position of the input and output nodes of the modified test lattice in presence of the aforesaid input mechanical stimulus. A figure of merit of the modified test lattice is then calculated, on the basis of the positions of the input and output nodes, established by the aforesaid simulation, in presence of an input mechanical stimulus. Then, the step is performed of either accepting or rejecting the modified test lattice, or establishing a probability of acceptance of the modified test lattice, on the basis of a comparison between the figure of merit of the current test lattice and the parameter of merit of the modified test lattice. In conclusion of the whole of the steps which are iterated, the current test lattice for the subsequent iteration is defined as the initial lattice at the first iteration, or, in subsequent iterations, as the present current test lattice if the modified test lattice was rejected, or as the modified test lattice if it was accepted. The aforesaid iteration comprises at least one step in which a previously removed node is added again. Furthermore, the aforesaid iteration is repeated until a predetermined optimization criterion of the figure of merit is met. At the end of the iteration, the method provides considering the current test lattice determined by the last iteration as the final design model of the mechanical actuator 1 and providing digital data corresponding to the aforesaid final design model for manufacturing the mechanical actuator by metamaterial. A method for making a mechanical actuator 1 and a method for making a metamaterial machine, based on the aforesaid design method, are also described.
UNIVERSITA' DEGLI STUDI DI MILANO – BICOCCA (Italy)
FONDAZIONE IRCCS CA' GRANDA - OSPEDALE MAGGIORE POLICLINICO (Italy)
Inventor
Monguzzi, Angelo Maria
Villa, Chiara
Torrente, Yvan
Abstract
The present invention relates to superstructured gold clusters Au-pX, consisting of gold atoms and at least one ligand, where said gold atoms in said cluster are in a number between 2 and 100 or the dimensions of said cluster are smaller than 2 nm, for use in the treatment of pathologies related to oxidative stress. In a preferred embodiment, said Au-pX superstructured gold clusters are for use in the treatment of Friedreich's ataxia.
A61P 25/28 - Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
96.
DEVICE AND METHOD FOR THE MEASUREMENT OF INCLINATION AND ANGULAR STABILITY OF ELECTROMAGNETIC RADIATION BEAMS, AND FOR THE MEASUREMENT OF A SPATIAL SHIFT OF A FOCUSED ELECTROMAGNETIC RADIATION BEAM
CENTRE NATIONAL DE LA RECHERCHE SCIENTIFIQUE (France)
ECOLE POLYTECHNIQUE (France)
Inventor
Cialdi, Simone
Cipriani, Daniele Ernesto
Capra, Stefano
Mathieu, François
Mazzotta, Zeudi
Abstract
A device 1 for measuring an angular inclination and angular inclination fluctuations of an electromagnetic radiation beam is described. This device is adapted to detect the incidence angular inclination θ and the relative fluctuations Δθ with respect to a nominal axis of propagation of the beam, in a desired detection plane comprising the nominal propagation axis. The device 1 comprises a first screen 11, a second screen 12 and at least one first electromagnetic power and/or energy detector Ps. The first screen 11 comprises a first slit S1 having a first slit dimension d1 along a first direction x1 on a detection plane transverse to the first slit. The first slit S1 is adapted to determine, when crossed by the beam, a diffraction of the beam, so as to generate downstream of the first screen 11 a diffracted electromagnetic field having on the detection plane a diffraction pattern dependent on the aforementioned angular inclination of incidence θ of the beam. The second screen 12 comprises a second slit S2 having a second slit dimension d2 along a second direction x2, parallel to the aforementioned first direction x1 on the detection plane. The second slit S2 is parallel to the first slit S1 in a direction y perpendicular to the aforementioned first and second directions (x1, x2), and is arranged in a selection position (X) on a scale defined on the second direction x2. The second screen 12 is arranged downstream of the first screen, with respect to the propagation of the beam, and is configured to shield the diffracted electromagnetic field with the exception of a transmitted portion of diffracted electromagnetic field, passing through the second slit S2. The at least one first electromagnetic power and/or energy detector Ps is arranged downstream of the second slit S2, with respect to the propagation of the beam, and is configured to detect the electromagnetic power and/or energy of the transmitted portion of diffracted electromagnetic field, dependent from the diffraction figure. This at least one first electromagnetic power and/or energy detector Ps is further configured to generate a first electrical signal Vs, based on the detected electromagnetic power and / or energy. Since the power and/or electromagnetic energy detected by the first detector depends on the geometry, or on the diffraction pattern, of the diffracted electromagnetic field, which in turn depends on the incidence angular inclination θ of the beam in the detection plane, the aforesaid first electrical signal Vs is representative of the angular inclination of incidence θ of the beam in the detection plane. A system and a method for measuring an angular inclination and angular inclination fluctuations of an electromagnetic radiation beam, using the aforementioned device, are also described. A method for measuring a spatial shift s of a focused laser beam, at the focusing point, with respect to a reference optical axis, is also described.
G01B 11/26 - Measuring arrangements characterised by the use of optical techniques for measuring angles or tapersMeasuring arrangements characterised by the use of optical techniques for testing the alignment of axes
G01B 11/27 - Measuring arrangements characterised by the use of optical techniques for measuring angles or tapersMeasuring arrangements characterised by the use of optical techniques for testing the alignment of axes for testing the alignment of axes
G01B 11/275 - Measuring arrangements characterised by the use of optical techniques for measuring angles or tapersMeasuring arrangements characterised by the use of optical techniques for testing the alignment of axes for testing wheel alignment
97.
USE OF A POLYESTER POLYMER AS PLASTICIZERS FOR POLYAMIDES
Subject-matter of the present invention is the use of a polyester polymer as plasticizer for polyamides, a method for plasticizing the polyamides and the so-produced polyamides.
The present disclosure relates to methods of treating cancer and pharmaceutical compositions for use in the treatment of cancer, including LSD1-inhibitor-resistant cancers, comprising administering to a subject an effective amount of a cell cycle inhibitor, such as a CDK4/6 inhibitor or a p21 enhancer, and an effective amount of a LSD1 inhibitor.
A61K 31/135 - Amines, e.g. amantadine having aromatic rings, e.g. methadone
A61K 31/165 - Amides, e.g. hydroxamic acids having aromatic rings, e.g. colchicine, atenolol, progabide
A61K 31/167 - Amides, e.g. hydroxamic acids having aromatic rings, e.g. colchicine, atenolol, progabide having the nitrogen atom of a carboxamide group directly attached to the aromatic ring, e.g. lidocaine, paracetamol
A61K 31/325 - Carbamic acidsThiocarbamic acidsAnhydrides or salts thereof
A61K 31/343 - Heterocyclic compounds having oxygen as the only ring hetero atom, e.g. fungichromin having five-membered rings with one oxygen as the only ring hetero atom, e.g. isosorbide condensed with a carbocyclic ring, e.g. coumaran, bufuralol, befunolol, clobenfurol, amiodarone
A61K 31/366 - Lactones having six-membered rings, e.g. delta-lactones
A61K 31/4025 - Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having five-membered rings with one nitrogen as the only ring hetero atom, e.g. sulpiride, succinimide, tolmetin, buflomedil not condensed and containing further heterocyclic rings, e.g. cromakalim
A61K 31/4045 - Indole-alkylaminesAmides thereof, e.g. serotonin, melatonin
A61K 31/407 - Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having five-membered rings with one nitrogen as the only ring hetero atom, e.g. sulpiride, succinimide, tolmetin, buflomedil condensed with heterocyclic ring systems, e.g. ketorolac, physostigmine
A61K 31/4155 - 1,2-Diazoles not condensed and containing further heterocyclic rings
A61K 31/4184 - 1,3-Diazoles condensed with carbocyclic rings, e.g. benzimidazoles
A61K 31/437 - Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with one nitrogen as the only ring hetero atom ortho- or peri-condensed with heterocyclic ring systems the heterocyclic ring system containing a five-membered ring having nitrogen as a ring hetero atom, e.g. indolizine, beta-carboline
A61K 31/4406 - Non-condensed pyridinesHydrogenated derivatives thereof only substituted in position 3, e.g. zimeldine
A61K 31/4439 - Non-condensed pyridinesHydrogenated derivatives thereof containing further heterocyclic ring systems containing a five-membered ring with nitrogen as a ring hetero atom, e.g. omeprazole
A61K 31/445 - Non-condensed piperidines, e.g. piperocaine
A61K 31/473 - QuinolinesIsoquinolines ortho- or peri-condensed with carbocyclic ring systems, e.g. acridines, phenanthridines
A61K 31/495 - Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with two nitrogen atoms as the only ring hetero atoms, e.g. piperazine
A61K 31/496 - Non-condensed piperazines containing further heterocyclic rings, e.g. rifampin, thiothixene or sparfloxacin
A61K 31/506 - PyrimidinesHydrogenated pyrimidines, e.g. trimethoprim not condensed and containing further heterocyclic rings
A61K 31/519 - PyrimidinesHydrogenated pyrimidines, e.g. trimethoprim ortho- or peri-condensed with heterocyclic rings
A61K 31/549 - Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with at least one nitrogen and at least one sulfur as the ring hetero atoms, e.g. sulthiame having two or more nitrogen atoms in the same ring, e.g. hydrochlorothiazide
The disclosure relates to a conditioning device (1) for conditioning at least one portion of an exposed stretch (2) of a blood vessel (3) for collecting biological material for grafting, comprising an envelope (4); at least one conveying channel (7) which extends entirely within the envelope and comprises at least one first aperture (11) leading out of the envelope, so that said at least one conveying channel can be supplied with working fluid (14) through said at least one first aperture; said envelope comprising a first layer (15) comprising a first surface intended to face said exposed stretch, and a second layer (16) comprising a second surface, opposite to said first surface; wherein said first layer is permeable to at least one component of the working fluid, so that said at least one component may diffuse from the conveying channel to the first surface. A method for collecting autologous biological material for grafting, e.g. for coronary bypass, is also disclosed.